The URL can be used to link to this page

Res No 017-25-16309RESOLUTION NO.017-25-16309 A RESOLUTION OF THE MAYOR AND CITY COMMISSION OF THE CITY OF SOUTH MIAMI, FLORIDA,APPROVING SFM JANITORIAL SERVICES, LLC AND FLORIDA PREFERRED GROUP,LLC FOR JANITORIAL SERVICES FOR UP TO A FIVE-YEAR TERM;AUTHORIZING THE CITY MANAGER TO NEGOTIATE AND TO ENTER INTO AGREEMENTS FOR JANITORIAL SERVICES WITH EACH OF THE CONTRACTORS;PROVIDING FOR IMPLEMENTATION, CORRECTIONS,AND AN EFFECTIVE DATE. WHEREAS,on December 18,2024,the City of South Miami (the “City”)issued Request for Proposals No.FN2024-17 (the “RFP”)for janitorial services for all City facilities and buildings (the “Services”);and WHEREAS,the City received twenty-one (21)proposals by the RFP deadline on January 23,2025;and WHEREAS,on February 10,2025,an Evaluation Selection Committee (“Committee”) appointed by the City Manager reviewed the proposals and short-listed five (5)proposers for oral interviews with the short-listed proposers;and WHEREAS,SFM Janitorial Services,LLC (“SFM”)was the top-ranked proposer and Florida Preferred Group,LLC (“FPG”)was the second-ranked proposal;and WHEREAS,although SFM ranked higher than FPG,the pricing offered by FPG for certain facilities and locations within the City is more advantageous than the pricing offered by SFM;and WHEREAS,the City desires to divide the RFP award to SFM and FPG based on the lowest pricing offered for the Services at each facility and location;and WHEREAS,specifically,the City desires to award an agreement to SFM for the provision of the Services at the Sylva Martin Building and Porche,City Hall (1st and 2nd Floor),and the Police Department (1st and 2nd Floor)(collectively,the “SFM Locations”)and to FPG for the provision of the Services at the Community Center,Basketball Court,the Marhsall Williamson Building (aka Mobley Building),and the Senior Citizens Center (collectively,the “FPG Locations”);and WHEREAS,the City Commission desires to select SFM for the Services at the SFM Locations and FPG for the Services at the FPG Locations,and approves and authorizes the City Manager to negotiate and enter into an agreement with SFM and FPG in substantially the form attached hereto as Exhibit “A”for a five (5)year term in an amount not to exceed $317,1 17.21 and $237,524.90,respectively,for the five (5)year term;and Page 1 of 3 Res.No.017-25-16309 WHEREAS,the cost of the Services will be charged to Account No.001-1710-519-3450, or such other funding source(s)as determined by the City Manager to be in the best interests of the City;and WHEREAS,the City Commission finds that this Resolution is in the best interest and welfare of the City. NOW,THEREFORE,BE IT RESOLVED BY THE MAYOR AND CITY COMMISSION OF THE CITY OF SOUTH MIAMI,FLORIDA,AS FOLLOWS: Section 1.Recitals.The above-stated recitals are true and correct and are incorporated herein by this reference. Section 2.Approval.The City Commission hereby approves the award of an agreement for the Services for a five (5)year term (inclusive of two (2)one-year renewal options) to SFM and FPG. Section 3.Authorization.The City Commission hereby authorizes the City Manager to negotiate and execute an agreement,in substantially the form attached hereto as Exhibit “A,” with SFM for the SFM Locations and FPG for the FPG Locations in an amount not to exceed $317,117.21 and $237,524.90,respectively,for a five-year term (inclusive of two (2)one-year renewal options),subject to the approval of the City Attorney and City Manager as to form, content,and legal sufficiency.The cost for the Services shall be charged to Account No.001- 1710-519-3450,which has a balance of $124,745.00 prior to this request,or such other funding source(s)as determined by the City Manager to be in the best interest of the City. Section 4.Implementation.The City Manager is hereby authorized to take all actions necessary to implement the purposes and intent of this Resolution. Section 5.Corrections.Conforming language or technical scrivener-type corrections may be made by the City Attorney for any conforming amendments to be incorporated into the final resolution for signature. Section 6.Effective Date.This Resolution shall become effective immediately upon adoption. PASSED AND ADOPTED this 18th day of March.2025. APPROVED: CITY MAYORC Page 2 of 3 Res.No.017-25-16309 READ AND APPROVED AS TO FORM,COMMISSION VOTE:5-0 LANGUAGE,LEGALITY AND Mayor Javier Fernandez:Yea EXECUTION THEREOF Vice Mayor Brian Corey:Yea Commissioner Lisa Bonich:Yea r Commissioner Steve Calle:Yea Commissioner Danny Rodriguez:Yea WEISS SEROTA ^ELFMAN COLE &BIERMAN,P.L. CITY ATTORNEY Page 3 of 3 Agenda Item No:3. City Commission Agenda Item Report Meeting Date: March 18, 2025 Submitted by: Steven Kulick Submitting Department: Public Works & Engineering Item Type: Resolution Agenda Section: Subject: A RESOLUTION OF THE MAYOR AND CITY COMMISSION OF THE CITY OF SOUTH MIAMI, FLORIDA, APPROVING SFM JANITORIAL SERVICES, LLC FOR JANITORIAL SERVICES FOR UP TO A FIVE-YEAR TERM; AUTHORIZING THE CITY MANAGER TO NEGOTIATE AND TO ENTER INTO AN AGREEMENT FOR JANITORIAL SERVICES FOR THE CITY; PROVIDING FOR IMPLEMENTATION, CORRECTIONS, AND AN EFFECTIVE DATE. 3/5 (CITY MANAGER) Suggested Action: Attachments: CM_Memo_Janitoral_Services_3.18.25.docx 4AP7160-Resolution-Janitorial_Services.docx Exhibit A-PSA Janitorial Services - RFP V1.DOCX FINAL RFP for Janitorial Services 12.18.24.pdf SFM Bidding Document.PDF Revised Bid Tabulation Janitorial Svcs 1.24.25.pdf DEMAND STAR Janitorial Svcs 1.23.25.pdf Revised Short List Scores RFP FN2024-17 2.10.25.pdf Final Scores and Rank RFP FN2024-17 2.19.25.pdf Fla Prefered Grp Bidding Document.PDF Marsden Svcs Bidding Document.PDF High Maintenance Bidding Document.PDF Kleen Tech Svc Bidding Document.PDF 1 Advertisment .pdf Sun Biz SFM Janitorial LLC.pdf Ad.pdf 2 CITY OF SOUTH MIAMI OFFICE OF THE CITY MANAGER INTER-OFFICE MEMORANDUM TO:The Honorable Mayor, Vice Mayor, and Members of the City Commission FROM:Genaro “Chip” Iglesias,City Manager DATE:March 18, 2025 SUBJECT:Janitorial Services for City Facilities-Five (5) Year Agreement ($777,028.00) RECOMMENDATION:Authorize the City Manager to enter into a five-year agreement with SFM Janitorial Services, LLC for Janitorial Services for City. BACKGROUND:The City’s current Janitorial Services contract with Clean Spaces, Inc. expires September 2025 with a set schedule of fees annually over the 5- year term.However, Clean Spaces requested a price increase on August 27, 2024,to their Year 5 Schedule of Fees due to unanticipated increased labor costs and requested to either extend the contract at a new rate or cancel the contract.As a result of this action, staff issued a solicitation for a new contract and issued a month-to-month contract to Clean Space.The month-to-month terms out on March 31, 2025,and continues the same level of service, at a new monthly rate of $6,800.00 from the current rate of $4,341.00, while the solicitation process is underway ensuring no loss of services during scope development and the solicitation process. The Janitorial Services Request for Proposal was issued on December 18, 2024,and closed on January 23, 2025.The scope of services includes the Sylva Martin Building, City Hall, Police Department, Community Center, Marshall Williamson Building, Senior Center, Public Works and Motor Pool, and the office facility at Dante Fascell Park. Twenty-one (21) proposals were received and were reviewed by the Procurement Division for responsiveness.One proposal was deemed non- responsive (Green Facility) as they submitted pricing for a three-year period and not over the 5-year period as specified in the RFP.The remaining proposals are responsive and meet the requirements of the solicitation.The proposals received are summarized below: Proposer Bid Price (5-Year) Able Business (2004)$452,500.00 3 South'*’Miami THE CITY OF PLEASANT LIVING CITY OF SOUTH MIAMI OFFICE OF THE CITY MANAGER INTER-OFFICE MEMORANDUM Marsden South $465,420.71 ELLA'S PROPERTY $479,000.00 Clean Space (Incumbent)$479,563.79 High Maintenance $491,311.17 Unlimited $565,132.00 FLA Preferred $588,677.01 National Cleaning $656,559.86 Klen Space $689,748.77 Green Facility (3-Year Pricing Only) $720,647.02 (NON- RESPONSIVE) Comet Cleaning/Alpha $740,091.00 Chi-Ada $755,635.12 Pro Alliance/DVE Capital $758,527.05 SFM $777,028.00 Kleen Tech $860,360.00 WG Maintenance $896,950.00 MCJ Professional $1,094,342.78 Goodwill)$1,218,059.95 Ameri-Plus $1,370,259.20 Boss Pro Tampa $1,525,618.20 J B Consulting (Complete $2,575,149.14 An Evaluation Selection Committee comprised of Alex Munoz, Chairperson and Public Works Director; Quentin Pough, Parks and Recreation Director; and Captain John Barzola, South Miami Police Department met on February 10, 2025, to review, score and rank the proposals. The Committee’s scored and ranked the proposals received and based upon those rankings decided to identify a “short list” for oral interviews comprised of five (5) respondents summarized below: 4 $South ’Miami THE CITY OF PLEASA NT LIVING CITY OF SOUTH MIAMI OFFICE OF THE CITY MANAGER INTER-OFFICE MEMORANDUM TOP FIVE FOR INTERVIEWS BIDDER Q. POUGH A.MUNOZ J. BARZOLA TOTAL SCORE SHORT LIST RANK FIVE-YEAR BID PRICE SFM 96 95 82 273 1 $777,028.00 FLA Preferred 84 86 78 248 2 $588,677.01 Marsden South 85 70 80 235 3 $465,420.71 Kleen Tech 81 90 56 227 4 $860,360.00 High Maint.75 69 85 229 5 $491,311.17 In accordance with the Selection Process published in the RFP oral interviews are worth a maximum of 25 additional points and shall be added to the Evaluation Committees Final Scoring for each Proposer. Oral interviews were held in the Commission Chambers and scheduled for February 19, 2025. After completion of the oral interviews, the Evaluation Selection Committee completed their “final scores,” and are summarized below: TOP FIVE FOR INTERVIEWS 2/19/2025 BIDDER Q. POUGH A.MUNOZ J. BARZOLA TOTAL SCORE SHORT LIST RANK Interview Max 25 Points FINAL TOTAL FINAL RANK FIVE-YEAR BID PRICE SFM 96 95 82 273 1 75 348 1 $777,028.00 FLA Preferred 84 86 78 248 2 58 306 2 $588,677.01 Marsden South 85 70 80 235 3 62 297 3 $465,420.71 High Maint.75 69 85 229 4 60 289 5 $860,360.00 Kleen Tech 81 90 56 227 5 67 294 4 $491,311.17 5 South'*’Miami THE CITY OF PLEASANT LIVING CITY OF SOUTH MIAMI OFFICE OF THE CITY MANAGER INTER-OFFICE MEMORANDUM Public Works anticipated janitorial services costs to increase and for FY 2024 – 2025 increased the budget to $130,000. Historically, the City has selected contractors that were on the lower end of the bid prices received. Generally, these contractors paid lower wages to staff with little or no benefits. Consequently, the City experienced high turnover in contractor staff resulting in inconsistent and sub-standard service. The highest ranked respondent, SFM Janitorial, has been a local business located in Medley FL, since 1972. SFM serves over 20 municipalities and numerous high-profile commercial properties across Monroe, Miami- Dade, Broward, and Palm Beach counties. SFM has provided services for venues such as the Ultra Music Festival and the Miami-Dade County Youth Fair, as well as educational institutions, medical facilities, including Baptist Health, and other 24/7 operations. Some of their municipal clients include; City of Coral Gables, City of Miami Beach, City of Miami Springs, Town of Miami Lakes, Town of Cutler Bay, Village of Palmetto Bay, City of Miami Gardens and City of Hialeah. Approximately 1,000 employees are on the SFM’s payroll, and their retention plan is to pay cleaning staff on the contract 8.00% above the Florida minimum wage. Benefits include paid life insurance to all full-time employees and all staff are eligible for performance bonuses and free uniforms. Note: As of September 2024, the minimum wage for non-tipped employees is $13.00 and will increase by $1.00 per year until the minimum wage reaches $15.00 by September 2026. The proposed staffing level for South Miami includes three (3) Part Time cleaners and an Account Manager. To manage the account, SFM will utilize a “Client Ticket System” using QC Technology (QR System) as a response process for emergency cleaning issues that sends continuous alerts until the issue is corrected by the Account Manager. Daily time-stamped reports are generated that monitors when SFM staff begins and ends the cleaning process at each City facility included in the scope of services. Special cleaning requests and emergencies are manned by an on-call SFM account manager 24/7/365. An existing pool of floaters and approximately 60 employees from existing accounts that work within a 5-mile radius can be usedfor fill- ins and call outs. SFM also utilizes Biometric Fingerprint Equipped Time Clocks, a Mobile Tracking App to monitor services and Geo-fence technology to ensure roles are strategically allocated. The annual fee for SFM is broken down as follows: 6 South'*’Miami THE CITY OF PLEASANT LIVING CITY OF SOUTH MIAMI OFFICE OF THE CITY MANAGER INTER-OFFICE MEMORANDUM Year 1: $136,226 Year 2: $144,400 Year 3: $154,507 Year 4: $165,000 Year 5: $176,895 FUNDING:Janitorial services expenses shall be charged to account no. 001-1710-519- 3450 with a balance of $124,745.00 before this request has been made. ATTACHMENTS:Resolution RFP#FN20245-17 Bid Tabulation Demand Star Results Short List Scores and Rank Final Scores and Rank Proposals: SFM, Florida Preferred, Marsden South, High Maintenance, Kleen Tech Advertisement Sun Biz: SFM Janitorial LLC 7 South'*’Miami THE CITY OF PLEASANT LIVING PROFESSIONALSERVICESAGREEMENTBETWEENTHECITYOFSOUTHMIAMIANDSFMJANITORIALSERVICES,LLCTHISAGREEMENT(this“Agreement”)ismadeeffectiveasofthel_dayofMAY,2025(the“EffectiveDate”),byandbetweentheCITYOFSOUTHMIAMI,aFloridamunicipalcorporation,(hereinafterthe“City”),andSFMJANITORIALSERVICES,LLC,aFloridalimitedliabilitycompany(hereinafter,the“Consultant”).WHEREAS,theCityrequiresjanitorialservicesatvariouslocationswithintheCity(the“Services”),assetforthingreaterdetailintheScopeofServicesattachedheretoasExhibit“A”;andWHEREAS,onDecember18,2025,theCityissuedRequestforProposalsNo.FN2024-17(the“RFP”)fortheServices,whichRFPisincorporatedbythisreferenceasiffullysetforthherein;andWHEREAS,theConsultantsubmittedaProposalinresponsetotheRFP,whichProposalisattachedheretoasExhibit“B”;andWHEREAS,onMarch18,2025,theCityCommissionadoptedResolutionNo.017-25-16309,approvingtheawardofthisAgreementtotheConsultantfortheprovisionoftheServicesattheSylvaMartinBuildingandPorch,CityHall(1stand2ndFloor),andthePoliceDepartment(1stand2ndFloor),PublicWorksFacility,DaneFascellPark(collectively,the“Locations”)inanamountnottoexceed$310,659.05overthethree-yeartermandthetwoadditionalone-yearrenewaloptionyearspursuanttotheRFP;andWHEREAS,theConsultantandCity,throughmutualnegotiation,haveagreeduponaRateSchedulefortheServicesattheLocations,whichRateScheduleisattachedheretoasExhibit“C”;andWHEREAS,theCitydesirestoengagetheConsultanttoperformtheServicesandprovidethedeliverablesasspecifiedbelow.NOW,THEREFORE,inconsiderationofthemutualcovenantsandconditionscontainedherein,theConsultantandtheCityagreeasfollows:1.ScopeofServices.1.1.ConsultantshallprovidetheServicesattheLocations,assetforthingreaterdetailintheRFP,theScopeofServicesattachedheretoasExhibit“A,”andtheProposal1of158 attachedheretoasExhibit“B”andincorporatedhereinbyreference(the“Services”).12.Consultantshallfurnishallreports,documents,andinformationobtainedpursuanttothisAgreement,andrecommendationsduringthetermofthisAgreement(hereinafter“Deliverables”)totheCity.2.Term/CommencementPate.2.1.ThetermofthisAgreementshallbefromtheEffectiveDatethroughthree(3)yearsthereafter,unlessearlierterminatedinaccordancewithParagraph8.22.ConsultantagreesthattimeisoftheessenceandConsultantshallcompletetheServiceswithinthetermofthisAgreement,unlessextendedbytheCityManager.Additionally,theCityManagermayrenewthisAgreementfortwo(2)additionalone-yearperiodsonthesametermsassetforthhereinuponwrittennoticetotheConsultantforatotaltermoffive(5)consecutiveyears.23.3.CompensationandPayment.3.1.CompensationforServicesprovidedbyConsultantshallbeinaccordancewiththeRatesScheduleattachedheretoasExhibit“C”inanamountnottoexceed$310,659.05overthethree-yeartermandthetwo(2)additionalone-yearrenewaloptionyears.Specifically,compensationfortheprovisionoftheServicesattheLocationsshallbeasfollows:3.1.1.YearOne:$4,501.72permonth,foranannualtotalnottoexceed$54,020.72;3.1.2.YearTwo:$4,816.84permonth,foranannualtotalnottoexceed$57,802.17;3.1.3.YearThree:$5,154.02monthly,foranannualtotalnottoexceed$61,848.32;and3.1.4.YearFour(OptionYear):$5,514.80monthly,foranannualtotalnottoexceed$66,177.70;and3.1.5.YearFive(OptionYear):$5,900.84monthly,foranannualtotalnottoexceed$70,810.14;and32.ConsultantshalldeliveraninvoicetoCitynomoreoftenthanoncepermonthdetailingServicescompletedandtheamountduetoConsultantunderthisAgreement.Feesshallbepaidinarrearseachmonth,pursuanttoConsultant’sinvoice,whichshallbebaseduponthepercentageofworkcompletedforeachtaskinvoiced.TheCityshallpaytheConsultantinaccordancewiththeFloridaPromptPaymentActafterapprovalandacceptanceoftheServicesbytheCityManager.2of158 4.Subconsultants.4.1.TheConsultantshallberesponsibleforallpaymentstoanysubconsultantsandshallmaintainresponsibilityforallworkrelatedtotheServices.42.ConsultantmayonlyutilizetheservicesofaparticularsubconsultantwiththepriorwrittenapprovaloftheCityManager,whichapprovalmaybegrantedorwithheldintheCityManager’ssoleandabsolutediscretion.5.Citv’sResponsibilities.5.1.Cityshallmakeavailableanymaps,plans,existingstudies,reports,staffandrepresentatives,andotherdatapertinenttotheServicesandinpossessionoftheCity,andprovidecriteriarequestedbyConsultanttoassistConsultantinperformingtheServices.52.UponConsultant’srequest,CityshallreasonablycooperateinarrangingaccesstopublicinformationthatmayberequiredforConsultanttoperformtheServices.6.Consultant’sResponsibilities;RepresentationsandWarranties.6.1.TheConsultantshallexercisethesamedegreeofcare,skillanddiligenceintheperformanceoftheServicesasisordinarilyprovidedbyaconsultantundersimilarcircumstances.IfatanytimeduringthetermofthisAgreementorwithintwo(2)yearsfromthecompletionofthisAgreement,itisdeterminedthattheConsultant’sDeliverablesorServicesareincorrect,notproperlyrendered,defective,orfailtoconformtoCityrequests,theConsultantshallatConsultant’ssoleexpense,immediatelycorrectitsDeliverablesorServices.6.2.TheConsultantherebywarrantsandrepresentsthatatalltimesduringthetermofthisAgreementitshallmaintainingoodstandingallrequiredlicenses,certificationsandpermitsrequiredunderFederal,StateandlocallawsapplicabletoandnecessarytoperformtheServicesforCityasanindependentcontractoroftheCity.Consultantfurtherwarrantsandrepresentsthatithastherequiredknowledge,expertise,andexperiencetoperformtheServicesandcarryoutitsobligationsunderthisAgreementinaprofessionalandfirstclassmanner.63.TheConsultantrepresentsthatisanentityvalidlyexistingandingoodstandingunderthelawsofFlorida.Theexecution,deliveryandperformanceofthisAgreementbyConsultanthavebeendulyauthorized,andthisAgreementisbindingonConsultantandenforceableagainstConsultantinaccordancewithitsterms.Noconsentofanyotherpersonorentitytosuchexecution,deliveryandperformanceisrequired.7.ConflictofInterest.7.1.Toavoidanyconflictofinterestoranyappearancethereof,Consultantshallnot,forthetermofthisAgreement,provideanyconsultingservicestoanyprivatesectorentities3of158 (developers,corporations,realestateinvestors,etc.),withanycurrent,orforeseeable,adversarialissuesintheCity.8.Termination.8.1.Eitherparty,withoutcause,mayterminatethisAgreementuponninety(90)calendardayswrittennoticetotheotherparty.TheCitymayterminatethisAgreementimmediatelywithcause.82.UponreceiptoftheCity'swrittennoticeoftermination,ConsultantshallimmediatelystopworkontheprojectunlessdirectedotherwisebytheCityManager.83.IntheeventofterminationbytheCity,theConsultantshallbepaidforallworkacceptedbytheCityManageruptothedateoftermination,providedthattheConsultanthasfirstcompliedwiththeprovisionsofParagraph8.4.8.4.TheConsultantshalltransferallbooks,records,reports,workingdrafts,documents,maps,anddatapertainingtotheServicesandtheprojecttotheCity,inahardcopyandelectronicformatwithinfourteen(14)daysfromthedateofthewrittennoticeofterminationorthedateofexpirationofthisAgreement.9.Insurance.9.1.ConsultantshallsecureandmaintainthroughoutthedurationofthisagreementinsuranceofsuchtypesandinsuchamountsnotlessthanthosespecifiedbelowassatisfactorytoCity,namingtheCityasanAdditionalInsured,underwrittenbyafirmratedA-XorbetterbyA.M.BestandqualifiedtodobusinessintheStateofFlorida.TheinsurancecoverageshallbeprimaryinsurancewithrespecttotheCity,itsofficials,employees,agents,andvolunteersnamingtheCityasadditionalinsured.AnyinsurancemaintainedbytheCityshallbeinexcessoftheConsultant’sinsuranceandshallnotcontributetotheConsultant’sinsurance.TheinsurancecoveragesshallincludeataminimumtheamountssetforthinthissectionandmaybeincreasedbytheCityasitdeemsnecessaryorprudent.9.1.1.CommercialGeneralLiabilitycoveragewithlimitsofliabilityofnotlessthana$1,000,000perOccurrencecombinedsinglelimitforBodilyInjuryandPropertyDamage.ThisLiabilityInsuranceshallalsoincludeCompletedOperationsandProductLiabilitycoveragesandeliminatetheexclusionwithrespecttopropertyunderthecare,custodyandcontrolofConsultant.TheGeneralAggregateLiabilitylimitandtheProducts/CompletedOperationsLiabilityAggregatelimitshallbeintheamountof$2,000,000each.9.1.2.WorkersCompensationandEmployer’sLiabilityinsurance,toapplyforallemployeesforstatutorylimitsasrequiredbyapplicableStateandFederallaws.Thepolicy(ies)mustincludeEmployer’sLiabilitywithminimumlimitsof$1,000,000.00eachaccident.Noemployee,subcontractororagentoftheConsultantshallbeallowedtoprovideServicespursuanttothisAgreementwhoisnotcoveredby4of158 Worker’sCompensationinsurance.9.1.3.BusinessAutomobileLiabilitywithminimumlimitsof$1,000,000peroccurrence,combinedsinglelimitforBodilyInjuryandPropertyDamage.CoveragemustbeaffordedonaformnomorerestrictivethanthelatesteditionoftheBusinessAutomobileLiabilitypolicy,withoutrestrictiveendorsements,asfiledbytheInsuranceServiceOffice,andmustincludeOwned,Hired,andNon-OwnedVehicles.9.1.4.ProfessionalLiabilityInsuranceinanamountofnotlessthanOneMillionDollars($1,000,000.00)peroccurrence,singlelimit.92.CertificateOfInsurance.CertificatesofInsuranceshallbeprovidedtotheCity,reflectingtheCityasanAdditionalInsured(exceptwithrespecttoProfessionalLiabilityInsuranceandWorker’sCompensationInsurance),nolaterthanten(10)daysafterawardofthisAgreementandpriortotheexecutionofthisAgreementbyCityandpriortocommencingServices.Eachcertificateshallincludenolessthan(30)thirty-dayadvancewrittennoticetoCitypriortocancellation,termination,ormaterialalterationofsaidpoliciesorinsurance.TheConsultantshallberesponsibleforassuringthattheinsurancecertificatesrequiredbythisSectionremaininfullforceandeffectforthedurationofthisAgreement,includinganyextensionsorrenewalsthatmaybegrantedbytheCity.TheCertificatesofInsuranceshallnotonlynamethetypesofpolicy(ies)provided,butalsoshallreferspecificallytothisAgreementandshallstatethatsuchinsuranceisasrequiredbythisAgreement.TheCityreservestherighttoinspectandreturnacertifiedcopyofsuchpolicies,uponwrittenrequestbytheCity.IfapolicyisduetoexpirepriortothecompletionoftheServices,renewalCertificatesofInsuranceshallbefurnishedthirty(30)calendardayspriortothedateoftheirpolicyexpiration.Eachpolicycertificateshallbeendorsedwithaprovisionthatnotlessthanthirty(30)calendardays’writtennoticeshallbeprovidedtotheCitybeforeanypolicyorcoverageiscancelledorrestricted.AcceptanceoftheCertificate(s)issubjecttoapprovaloftheCity.93.AdditionalInsured.ExceptwithrespecttoProfessionalLiabilityInsuranceandWorker’sCompensationInsurance,theCityistobespecificallyincludedasanAdditionalInsuredfortheliabilityoftheCityresultingfromServicesperformedbyoronbehalfoftheConsultantinperformanceofthisAgreement.TheConsultant’sinsurance,includingthatapplicabletotheCityasanAdditionalInsured,shallapplyonaprimarybasisandanyotherinsurancemaintainedbytheCityshallbeinexcessofandshallnotcontributetotheConsultant’sinsurance.TheConsultant’sinsuranceshallcontainaseverabilityofinterestprovisionprovidingthat,exceptwithrespecttothetotallimitsofliability,theinsuranceshallapplytoeachInsuredorAdditionalInsured(forapplicablepolicies)inthesamemannerasifseparatepolicieshadbeenissuedtoeach.9.4.Deductibles.Alldeductiblesorself-insuredretentionsmustbedeclaredtoandbereasonablyapprovedbytheCity.TheConsultantshallberesponsibleforthepaymentofanydeductibleorself-insuredretentionsintheeventofanyclaim.9.5.TheprovisionsofthissectionshallsurviveterminationofthisAgreement.5of158 10.Nondiscrimination,DuringthetermofthisAgreement,Consultantshallnotdiscriminateagainstanyofitsemployeesorapplicantsforemploymentbecauseoftheirrace,color,religion,sex,ornationalorigin,andtoabidebyallFederalandStatelawsregardingnondiscrimination.11.AttorneysFeesandWaiverofJuryTrial.11.1.IntheeventofanylitigationarisingoutofthisAgreement,theprevailingpartyshallbeentitledtorecoveritsattorneys’feesandcosts,includingthefeesandexpensesofanyparalegals,lawclerksandlegalassistants,andincludingfeesandexpenseschargedforrepresentationatboththetrialandallappellatelevels.112.INTHEEVENTOFANYLITIGATIONARISINGOUTOFTHISAGREEMENT,EACHPARTYHEREBYKNOWINGLY,IRREVOCABLY,VOLUNTARILYANDINTENTIONALLYWAIVESITSRIGHTTOTRIALBYJURY.12.Indemnification.12.1.ConsultantshallindemnifyandholdharmlesstheCity,itsofficers,agentsandemployees,fromandagainstanyandalldemands,claims,losses,suits,liabilities,causesofaction,judgmentordamages,arisingfromConsultant’sperformanceornon¬performanceofanyprovisionofthisAgreement,including,butnotlimitedto,liabilitiesarisingfromcontractsbetweentheConsultantandthirdpartiesmadepursuanttothisAgreement.ConsultantshallreimbursetheCityforallitsexpensesincludingreasonableattorneys’feesandcostsincurredinandaboutthedefenseofanysuchclaimorinvestigationandforanyjudgmentordamagesarisingfromConsultant’sperformanceornon-performanceofthisAgreement.122.NothinghereinisintendedtoserveasawaiverofsovereignimmunitybytheCitynorshallanythingincludedhereinbeconstruedasconsenttobesuedbythirdpartiesinanymatterarisingoutofthisAgreementoranyothercontract.TheCityissubjecttosection768.28,FloridaStatutes,asmaybeamendedfromtimetotime.123.TheprovisionsofthissectionshallsurviveterminationofthisAgreement.13.Notices/AuthorizedRepresentatives.AnynoticesrequiredbythisAgreementshallbeinwritingandshallbedeemedtohavebeenproperlygiveniftransmittedbyhand-delivery,byregisteredorcertifiedmailwithpostageprepaidreturnreceiptrequested,orbyaprivatepostalservice,addressedtotheparties(ortheirsuccessors)attheaddresseslistedonthesignaturepageofthisAgreementorsuchotheraddressasthepartymayhavedesignatedbypropernotice.14.GoverningLawandVenue.ThisAgreementshallbeconstruedinaccordancewithandgovernedbythelawsoftheStateofFlorida.VenueforanyproceedingsarisingoutofthisAgreementshallbeproperexclusivelyinMiami-DadeCounty,Florida.6of158 15.EntireAgreement/Modification/Amendment15.1.ThiswritingcontainstheentireAgreementofthepartiesandsupersedesanypriororalorwrittenrepresentations.Norepresentationsweremadeorrelieduponbyeitherparty,otherthanthosethatareexpresslysetforthherein.152.Noagent,employee,orotherrepresentativeofeitherpartyisempoweredtomodifyoramendthetermsofthisAgreement,unlessexecutedwiththesameformalityasthisdocument.16.OwnershipandAccesstoRecordsandAudits.16.1.Consultantacknowledgesthatallinventions,innovations,improvements,developments,methods,designs,analyses,drawings,reports,compiledinformation,andallsimilarorrelatedinformation(whetherpatentableornot)whichrelatetoServicestotheCitywhichareconceived,developedormadebyConsultantduringthetermofthisAgreement(“ServicesProduct”)belongtotheCity.ConsultantshallpromptlydisclosesuchServicesProducttotheCityandperformallactionsreasonablyrequestedbytheCity(whetherduringorafterthetermofthisAgreement)toestablishandconfirmsuchownership(including,withoutlimitation,assignments,powersofattorneyandotherinstruments).162.ConsultantagreestokeepandmaintainpublicrecordsinConsultant’spossessionorcontrolinconnectionwithConsultant’sperformanceunderthisAgreement.TheCityManagerorherdesigneeshall,duringthetermofthisAgreementandforaperiodofthree(3)yearsfromthedateofterminationofthisAgreement,haveaccesstoandtherighttoexamineandauditanyrecordsoftheConsultantinvolvingtransactionsrelatedtothisAgreement.ConsultantadditionallyagreestocomplyspecificallywiththeprovisionsofSection119.0701,FloridaStatutes.Consultantshallensurethatpublicrecordsthatareexemptorconfidentialandexemptfrompublicrecordsdisclosurerequirementsarenotdisclosed,exceptasauthorizedbylaw,forthedurationoftheAgreement,andfollowingcompletionoftheAgreementuntiltherecordsaretransferredtotheCity.163.UponrequestfromtheCity’scustodianofpublicrecords,ConsultantshallprovidetheCitywithacopyoftherequestedrecordsorallowtherecordstobeinspectedorcopiedwithinareasonabletimeatacostthatdoesnotexceedthecostprovidedbyChapter119,FloridaStatutes,orasotherwiseprovidedbylaw.16.4.Unlessotherwiseprovidedbylaw,anyandallrecords,includingbutnotlimitedtoreports,surveys,andotherdataanddocumentsprovidedorcreatedinconnectionwiththisAgreementareandshallremainthepropertyoftheCity.16.5.UponcompletionofthisAgreementorintheeventofterminationbyeitherparty,anyandallpublicrecordsrelatingtotheAgreementinthepossessionoftheConsultantshallbedeliveredbytheConsultanttotheCityManager,atnocosttotheCity,withinseven7of158 (7)days.AllsuchrecordsstoredelectronicallybyConsultantshallbedeliveredtotheCityinaformatthatiscompatiblewiththeCity’sinformationtechnologysystems.OncethepublicrecordshavebeendelivereduponcompletionorterminationofthisAgreement,theConsultantshalldestroyanyandallduplicatepublicrecordsthatareexemptorconfidentialandexemptfrompublicrecordsdisclosurerequirements.16.6.AnycompensationduetoConsultantshallbewithhelduntilallrecordsarereceivedasprovidedherein.16.7.Consultant’sfailureorrefusaltocomplywiththeprovisionsofthissectionshallresultintheimmediateterminationofthisAgreementbytheCity.16.8.NoticePursuanttoSection119.0701(2)(a),FloridaStatutes.IFTHECONSULTANTHASQUESTIONSREGARDINGTHEAPPLICATIONOFCHAPTER119,FLORIDASTATUTES,TOTHECONSULTANT’SDUTYTOPROVIDEPUBLICRECORDSRELATINGTOTHISAGREEMENT,CONTACTTHECUSTODIANOFPUBLICRECORDS.CustodianofRecords:Nkenga“Nikki”Payne,CMC,FCRMMailingaddress:6130SunsetDriveSouthMiami,FL33143Telephonenumber:305-663-6340Email:NPayne@southmiamifl.gov17.Nonassignability.ThisAgreementshallnotbeassignablebyConsultantunlesssuchassignmentisfirstapprovedbytheCityManager.TheCityisrelyingupontheapparentqualificationsandexpertiseoftheConsultant,andsuchfirm’sfamiliaritywiththeCity’sarea,circumstancesanddesires.18.Severability.IfanytermorprovisionofthisAgreementshalltoanyextentbeheldinvalidorunenforceable,theremainderofthisAgreementshallnotbeaffectedthereby,andeachremainingtermandprovisionofthisAgreementshallbevalidandbeenforceabletothefullestextentpermittedbylaw.19.IndependentConsultant.TheConsultantanditsemployees,volunteersandagentsshallbeandremainanindependentcontractorandnotanagentoremployeeoftheCitywithrespecttoalloftheactsandservicesperformedbyandunderthetermsofthisAgreement.ThisAgreementshallnotinanywaybeconstruedtocreateapartnership,associationoranyotherkindofjointundertaking,enterpriseorventurebetweentheparties.20.CompliancewithLaws.TheConsultantshallcomplywithallapplicablelaws,ordinances,rules,regulations,andlawfulordersofpublicauthoritiesincarryingoutServicesunderthisAgreement,andinparticularshallobtainallrequiredpermitsfromalljurisdictionalagenciestoperformtheServicesunderthisAgreementatitsownexpense.21.Waiver.ThefailureofeitherpartytothisAgreementtoobjecttoortotakeaffirmative8of158 actionwithrespecttoanyconductoftheotherwhichisinviolationofthetermsofthisAgreementshallnotbeconstruedasawaiveroftheviolationorbreach,orofanyfutureviolation,breachorwrongfulconduct.22.SurvivalofProvisions.AnytermsorconditionsofeitherthisAgreementthatrequireactsbeyondthedateofthetermoftheAgreement,shallsurviveterminationoftheAgreement,shallremaininfullforceandeffectunlessanduntilthetermsorconditionsarecompletedandshallbefullyenforceablebyeitherparty.23.ProhibitionofContingencyFees.TheConsultantwarrantsthatithasnotemployedorretainedanycompanyorperson,otherthanabonafideemployeeworkingsolelyfortheConsultant,tosolicitorsecurethisAgreement,andthatithasnotpaidoragreedtopayanyperson(s),company,corporation,individualorfirm,otherthanabonafideemployeeworkingsolelyfortheConsultant,anyfee,commission,percentage,gift,oranyotherconsideration,contingentuponorresultingfromtheawardormakingofthisAgreement.24.StateRequiredAffidavits,ByenteringintothisAgreement,theConsultantagreestoreviewandcomplywiththefollowingstateaffidavitrequirements:24.1.PublicEntityCrimesAffidavit.ConsultantshallcomplywithSection287.133,FloridaStatutes(PublicEntityCrimesStatute),notificationofwhichisherebyincorporatedhereinbyreference,includingexecutionofanyrequiredaffidavit.242.ScrutinizedCompanies.ConsultantcertifiesthatitisnotontheScrutinizedCompaniesthatBoycottIsraelListorengagedinaboycottofIsrael.Pursuanttosection287.135,FloridaStatues,theCitymayimmediatelyterminatethisAgreementatitssoleoptioniftheConsultantisfoundtohavesubmittedafalsecertification;oriftheConsultantisplacedontheScrutinizedCompaniesthatBoycottIsraelListorisengagedintheboycottofIsraelduringthetermoftheAgreement.IfthisAgreementisformorethanonemilliondollars,theConsultantcertifiesthatitisalsonotontheScrutinizedCompanieswithActivitiesinSudan,ScrutinizedCompanieswithActivitiesintheIranTerrorismSectorsList,ScrutinizedCompanieswithActivitiesintheIranPetroleumEnergySectorList,orengagedwithbusinessoperationsinCubaorSyriaasidentifiedinSection287.135,FloridaStatutes.PursuanttoSection287.135,FloridaStatutes,theCitymayimmediatelyterminatethisAgreementatitssoleoptioniftheConsultantisfoundtohavesubmittedafalsecertification;oriftheConsultantisplacedontheScrutinizedCompanieswithActivitiesinSudanList,ScrutinizedCompanieswithActivitiesintheIranTerrorismSectorsList,ScrutinizedCompanieswithActivitiesinIranPetroleumEnergySectorList,orengagedwithbusinessoperationsinCubaorSyriaduringthetermoftheAgreement.243.E-VerifyAffidavit.InaccordancewithSection448.095,FloridaStatutes,theCityrequiresallcontractorsdoingbusinesswiththeCitytoregisterwithandusetheE-Verifysystemtoverifytheworkauthorizationstatusofallnewlyhiredemployees.TheCitywillnotenterintoacontractunlesseachpartytothecontractregisterswithandusestheE-Verifysystem.Thecontractingentitymustprovideofitsproofofenrollment9of158 inE-Verify.Forinstructionsonhowtoprovideproofofthecontractingentity’sparticipation/enrollmentinE-Verify,pleasevisit:https://www.e-verifv.gov/faq/how-do-i-provide-proof-of-my-participationenrollment-in-e-verifY.ByenteringintothisAgreement,theConsultantacknowledgesthatithasreadSection448.095,FloridaStatutes;willcomplywiththeE-VerifyrequirementsimposedbySection448.095,FloridaStatutes,includingbutnotlimitedtoobtainingE-Verifyaffidavitsfromsubcontractors;andhasexecutedtherequiredaffidavitattachedheretoandincorporatedherein.24.4.NoncoerciveConductAffidavit.PursuanttoSection787.06,FloridaStatutes,anongovernmentalentityexecuting,renewing,orextendingacontractwithagovernmentalentityisrequiredtoprovideanaffidavit,signedbyanofficerorarepresentativeofthenongovernmentalentityunderpenaltyofperjury,attestingthatthenongovernmentalentitydoesnotusecoercionforlabororservicesasdefinedinSection787.06(2)(a),FloridaStatutes.ByenteringintothisAgreement,theConsultantacknowledgesthatithasreadSection787.06,FloridaStatutes,andwillcomplywiththerequirementstherein,andhasexecutedtherequiredaffidavitattachedheretoandincorporatedherein.24.5.ProhibitiononContractingwithEntitiesofForeignConcern.PursuanttoSection287.138,FloridaStatutes(whichisexpresslyincorporatedhereinbyreference),agovernmentalentitymaynotknowinglyenterintoacontractwithanentitywhichwouldgiveaccesstoanindividual’spersonalidentifyinginformationif(a)theentityisownedbythegovernmentofaforeigncountryofconcern;(b)thegovernmentofaforeigncountryofconcernhasacontrollinginterestintheentity;or(c)theentityisorganizedunderthelawsoforhasitsprincipalplaceofbusinessinaforeigncountryofconcern.ByenteringintothisAgreement,theConsultantacknowledgesthatithasreadSection287.138,FloridaStatutes,andcomplieswiththerequirementstherein,andhasexecutedtherequiredaffidavitattachedheretoandincorporatedherein.25.Counterparts.ThisAgreementmaybeexecutedinseveralcounterparts,eachofwhichshallbedeemedanoriginalandsuchcounterpartsshallconstituteoneandthesameinstrument.26.Conflicts;OrderofPriority.Thisdocumentwithoutexhibitsisreferredtoasthe“BaseAgreement.”IntheeventofaconflictbetweenthetermsofthisAgreementandanyexhibitsorattachmentshereto,oranydocumentsincorporatedhereinbyreference,theconflictshallberesolvedinthefollowingorderofprioritiesandthemorestringentcriteriaforperformanceoftheServicesshallapply:26.1.FirstPriority:BaseAgreement;262.SecondPriority:ExhibitA-theScopeofServices;263.ThirdPriority:ExhibitC-theRateSchedule;26.4.FourthPriority:theRFP;and26.5.FifthPriority:ExhibitB-Proposal.10of158 [Remainderofpageintentionallyleftblank.SignaturepageandStateRequiredAffidavitsfollow.]11of158 INWITNESSWHEREOF,thepartiesheretohavecausedthisAgreementtobeexecutedthedayandyearasfirststatedabove.Approvedastoformandlegalsufficiency:By:_WeissSc/otaHelfmanC#e&Bierman,P.L.CityAttorneyAddressesforNotice:Genaro"Chip”IglesiasCityofSouthMiamiAttn:CityManager6130SunsetDriveSouthMiami,FL33143305-668-2510(telephone)305-663-6345(facsimile)chip@southmiamifl.gov(email)Withacopyto:WeissSerotaHelfmanCole&Bierman,P.L.Attn:LillianArango,Esq.CityofSouthMiamiAttorney2800PoncedeLeonBoulevard,Suite1200CoralGables,FL33134larango@wsh-law.com(email)SFMJANITORIALSERVICES,LLCTitle:ManagerOwnerEntity:SFMJanitorialSendees,LLC.AddressesforNotice:ChristianInfanteSFMJanitorialSenices,LLC..2S0.QNW74AvenueMedley,FL33166305,818.2424x.l117(telephone)305.818.3510.(facsimile)cinfante@sfmservices.com(email)Withacopyto:CarlosTriay,ESQ2301NW87AvenueSuite501..DaraL£L33172305.597.8944(telephone)305.597.8995(facsimile)..cat@cattriay.com(emaiI)12of158 E-VERIFYAFFIDAVITInaccordancewithSection448.095,FloridaStatutes,theCityrequiresallcontractorsdoingbusinesswiththeCitytoregisterwithandusetheE-Verifysystemtoverifytheworkauthorizationstatusofallnewlyhiredemployees.TheCitywillnotenterintoacontractunlesseachpartytothecontractregisterswithandusestheE-Verifysystem.ThecontractingentitymustprovideofitsproofofenrollmentinE-Verify.Forinstructionsonhowtoprovideproofofthecontractingentity’sparticipation/enrollmentinE-Verify,pleasevisit:https://www.e-verify.Rov/faq/hPw-do-i-providc-proof-of-my-participationenro||ment-in-e-verifyBysigningbelow,thecontractingentityacknowledgesthatithasreadSection448.095,FloridaStatutesandwillcomplywiththeE-Vcrifyrequirementsimposedbyit,includingbutnotlimitedtoobtainingE-Verifyaffidavitsfromsubcontractors.SCheckheretoconfirmproofofenrollmentinE-VcrifyhasbeenattachedtothisAffidavit.Inthepresenceof:Signed,sealedauddeliveredby:Witnck/#!PrintName;„Witness#2PnntName:PrintNanvE/CmistianInfanteTitle:hpmager/OwnerEntityName:SFMJanitorialServices,LLC.ACKNOWLEDGMENTStateofFloridaCountyofMiami-DadeTheforegoinginstrumentwasacknowledgedbeforemebymeansof(3physicalpresenceoronline—-,Stamp,orType^R^E>p„cs3'23/2027unmissioned)XXPersonallyknowntome;orProducedidentification(TypeofIdentification:Didtakeanoath;orDidnottakeanoath)CAVa,1CZ2aDR’vera,2025,byChristianInfante(typeofauthority)foronbehalfoFwh6m)instrumentisexecuted).notarization,thisI11dayofMay(nameofperson)asManager/OwnerSFMJanitorialServices,LLC.(nameofpartyUHjaZ1;0.QCityofSouthMiami13of158E-VerifyAffidavit AFFIDAVITATTESTINGTONONCOERCIVECONDUCTFORLABORORSERVICESEffectiveJuly1,2024,Section787.06,FloridaStatutes,anongovernmentalentityexecuting,renewing,orextendingacontractwithagovernmentalentityisrequiredtoprovideanaffidavit,signedbyanofficerorarepresentativeofthenongovernmentalentityunderpenaltyofperjury,attestingthatthenongovernmentalentitydoesnotusecoercionforlabororservicesasdefinedinSection787.06(2)(a),FloridaStatutes.Bysigningbelow,Iherebyaffirmunderpenaltyofperjurythat:1.IhavereadSection787.06,FloridaStatutes,andunderstandthatthisaffidavitisprovidedincompliancewiththerequirementthat,uponexecution,renewal,orextensionofacontractbetweenanongovernmentalentityandagovernmentalentity,thenongovernmentalentitymustattesttotheabsenceofcoercioninlabororservices.2.IamanofficerorrepresentativeofSIMJanitorialSenices,LLC.,anongovernmentalentity.3.SFMJanitorialSenices,l.LC.docsnotusecoercionforlabororservicesasdefinedintherelevantsectionofthelaw.Inthepresenceof:Underpenaltiesofperjury,IdeclarethatIhavereadtheforegoingandthefactsstatedinitarctrue:WitnesffilPrintName:K&vn-UrtrtjrtpPrintName:Title:ManatIstpnInfante—j-Witness#2PrintName:i?nr"itOOwnerEntityName:SFMJanitorialServices,LIC.OATHORAFFIRMATIONStateofFloridaCountyofMi.imi-DadeCountySwornto(oraffirmed)andsubscribedbeforemebymeansofSphysicalpresenceoronlinenotarization,thisI”dayofMay,2025,byChristianInfante(nameOfperson)asManager/Owner(typeofauthority^forSFMJanitorialServices.Il.C.(nameofpartyonbehalfofwhominstrumentisexecuted)./Y//Personallyknowntome;orProducedidentification(TypeofIdentification:Didtakeanoath;orDidnottakeanoathCityofSouthMiamiNoncoerciveConductforLabororServicesAffidavit14of158 AFFIDAVITREGARDINGPROHIBITIONONCONTRACTINGWITHENTITIESOFFOREIGNCOUNTRIESOFCONCERNPursuanttoSection287.138,FloridaStatutes(whichisexpresslyincorporatedhereinbyreference),agovernmentalentitymaynotknowinglyenterintoacontractwithanentitywhichwouldgiveaccesstoanindividual'spersonalidentifyinginformationif(a)theentityisownedbyethegovernmentofaforeigncountryofconcent;(b)thegovernmentofaforeigncountryofconcernhasacontrollinginterestintheentity;or(c)theentityisorganizedunderthelawsoforhasitsprincipalplaceofbusinessinaforeigncountryofconcent.Thisaffidavitmustbecompletedbyanofficerorrepresentativeofanentitysubmittingabid,proposal,orreplyto,orenteringinto,renewing,orextending,acontractwithagovernmentalentitywhichwouldgranttheentityaccesstoanindividual’spersonalidentifyinginformation.I.SFMJanitorialServices,LLC.(“entity”)doesnotmeetanyofthecriteriainparagraphs(2)(a)-(c)ofSection287.138,F.S.Inthepresenceof:Underpenaltiesofperjury,IdeclarethatIhavereadtheforegoingandthefactsstatedinitarctrue:>Witness'#!PrintNagie;K&WtbHUWPrintNaiffejjprhtAtianInlanieTitle:f^Rager“wner..-ua.a—-—yapWith€ssp2PrintName:Ft«•CEntityName:SFMJanitorialServices,LLCOATHORAFFIRMATIONStateofFloridaCountyofMiami-DudeCountySwornto(oraffirmed)andsubscribedbeforemebymeansof®physicalpresenceoronlinenotarization,thisI"dayofMay,2025,byChristianInfante(nameofperson)asManagerOwner(typeofauthorily)forSFMJanitorialSeme(nameofpartyonbehalfofwhominstrumentisexecuted)./)//TypcasQXPersonallyknowntome;orVanezzaDRiveraProducedidentification(TypeofIdentification:XDidtakeanoath;orDidnottakeanoathCityofSouthMiamiProhibitiononContractingwithEntitiesofForeignCountriesofConcern15of158 EXHIBIT“A”SCOPEOFSERVICES3.1GeneralRequirements:TheCityofSouthMiamiisseekingproposalsfromexperiencedandcapablepartiestoprovidejanitorialservicesforallCityfacilitiesandbuildings.TheContractormustfurnishallmaterial,labor,suppliesandequipmentnecessarytoperformalloperationsinconnectionwithdailyjanitorialservicesfortheCityofSouthMiami.Thetermofthisagreementwillbeforaperiodofthree-years(3),withone(1)two-year(2)Optionto-RenewfromthedateofexecutionoftheagreementbetweentheCityandContractoratthediscretionoftheCityManager.3.2SiteSpecificationsandLocation:PleaserefertoAttachmentC,“JanitorialServiceLocationsMatrix,”andAttachmentD,“PhotographsofFloorTypesinServiceAreas,”fordetailsofeachfacilityidentifiedforthisproject;includingestimatedSquareFeet,Restrooms,Appliances,SinksandCounters,WindowsandWaterFountains.Cityfacilitiesandaddressesaredescribedas:a)SylvaMartinandPorch;CityHall(Is*&2ndFloor);CommissionChambers,PoliceDepartment(Is*&2ndFloor)-6130SunsetDrive,SouthMiami,Fl33143.PublicWorks&DanteFascellParkoServiceHours:•SylvaMartinBldg;CityHall(1st&2ndFloor)CommissionChambers(twiceonCommissionMeetingDays):•Monday-Friday:6PMto10PMPolice(1st&2ndFloor):•Monday-Friday:7AMto4PM•PublicWorks;Monday-Friday7AMto4PM•DanteFascellPark;Monday-Friday6AMto7:30AM3.3ResponsibilitiesoftheParties:TheContractormustperformalldutiesandprovidetherequiredmaterial,labor,suppliesandequipmentasidentifiedbelow:a)OFFICES-DailyService1.Emptyallwastereceptacles,removingwastetodesignatedareafordisposal,andreplaceplasticliners2.Emptyanddampwipegarbagereceptacles,3.Dustandspotcleanalldesktopsandcountertops.4.Dustallhorizontalsurfacesofdesks,chairs,tablesandofficeequipment.5.Dustallexposedfilingcabinets,bookcasesandshelves.6.Dustallhorizontalsurfacesofequipment,ledges,andsills,shelves,ventilatinglouvers,frames,partitions,etc.7.Cleanandsanitizealldrinkfountains.8.Removecobwebsfromwallsandceilings.9.Spotwashglasssurfaces(includingwindows),doors,frames,kickandpushplates,handles,lightswitches,baseboards,andsimilarsurfaces.Allsurfaceswillbecleanedwiththeutmostcare.10.Vacuumcleanallexposedcarpeting.11.Inspectcarpetforspotsandstains,removewherepossible.CityofSouthMiami16of158Exhibit“A' 12.Dustmoporsweepallnon-carpetedfloorsthoroughlyusingachemicallytreatedmop.13.Mopuncarpetedfloorsasneeded,minimum3timesperweek.14.Spotcleanspillswithadampmop.15.Beforeleavinganyoffice,shutofflights,electricalappliances,andshutdoor(s)16.Removefingerprintsandsmudgesfromallwalls.17.Reportallburnedoutlights.18.Detailandcleanallkitchen,countertops,orlunchroomareas,whereapplicable19.CleanStairsdaily,whereapplicable.20.Clean/WipeDownOfficeDesksb)OFFICES-WeeklyService1.Dustallledges,wallmoldings,pictures,shelves,andothersurfacesabove[handheight].2.Brushdownandcleanallventsandgrills3.Cleanallbaseboards.4.Dustalllightfixturesandcovers.5.Cleanallgroundlevelwindowsandglasspartitionsc)OFFICES-QuarterlyServiceI.Dustandcleanorvacuumalldrapesandblinds.2.Detailandvacuumchairsandupholsteredfurniture.3.Dustandcleanalllightfixturesandcovers.4.Scrubandwaxvinylfloors.d)BI-ANNUALSERVICEDeepcleaning,allcarpetsatallCityfacilities.Thoroughlycleanalloutsidewindowsandglasspartitions.Thismayalsoincludeadditionalrequestforserviceduringthiscleaningsession.(Stainremovaletc.)e)RESTROOMS-DailyService1.Emptytrashcontainersandremovetrashtodesignatedarea.2.Dampwipeorscrubandsanitizealltrashcontainers.3.AllCommodes,urinals,andbasinstobescouredanddisinfected.Bothsidesoftoiletseattobecleaneddaily.4.Cleanandpolishallfaucets,sinks,andexposedmetal.5.Allpipingtobecleanedandpolished.6.Allpartitionstobespotcleanedandwashedasnecessary.7.Replenishallpaperproducts,includingtoiletcovers,papertowelsandtoiletpaperdaily.8.Replenishhandsoapdaily.9.Sweeptilefloorsanddampmopwithgermicidaldisinfectant.f)RESTROOMS-WeeklyService1.Washdownallwallsandsanitizeallpartitions.2.Washallwastecontainersanddisinfect.3.Cleanandpolishalldoors,doorplates,andhardware.4.Allfloorscleanedandgroutcleaned.5.Cleanshowers.CityofSouthMiami17of158Exhibit“A” 5.Backgroundinformationonpersonsofsignificantresponsibilitywithintheproposer’sorganization.3.6JanitorialServicesLocations(6Buildings,4Locations)NOTE:RefertoAttachmentC,“JanitorialServiceLocationsMatrix,”andAttachmentD,“PhotographsofFloorTypesinServiceAreas”foradetaileddescriptionoftheCityfacilitiesincludedwiththisproject,includingestimatedsquarefootage,restrooms,appliances,sinksandcounters,waterfountains,etc.NOTE:ABIDBONDISNOTREQUIREDFORTHISPROJECTCityofSouthMiamiCityHall&SylvaMartinBuildingMaintenanceAreasCityHall6130SunsetDriveDownstairsMen’sBathroomsCityofSouthMiami19of158Exhibit“A” DownstairsUnisexBathroomCommissionChambersCityofSouthMiami20of158Exhibit“A' DeputyCityClerk’sOffice(2Offices)CityofSouthMiami21of158Exhibit“A” MayorandCommissioner'sOfficeUpstairsWomen’sBathroomCityofSouthMiami22of158Exhibit“A” SylvaMartinBuilding6130SunsetDriveEntrance&HallsCityofSouthMiami23of158Exhibit“A” BuildingDepartmentOffices(1Office&1SharedOfficeSpace)CityofSouthMiami24of158Exhibit“A” Women’sBathroomPoliceDepartmentMaintenanceAreasPoliceDepartment6130SunsetDriveCommunicationsArea(1SharedOfficeSpace)CityofSouthMiami25of158Exhibit“A” Men’sBathroomsWomen’sBathroomCityofSouthMiami26of158Exhibit“A’ CellsUpstairsOffice’s(5Offices&2SharedOfficeSpaces)CityofSouthMiami27of158Exhibit“A” UpstairsMen’sBathroomCityofSouthMiami28of158Exhibit“A” CityofSouthMiami29of158Exhibit“A” EXHIBIT“B”CONSULTANT’SPROPOSALCityofSouthMiami30of158Exhibit“B SFMJanitorialServices,LLC.,ProposaltoCityofSouthMiamRFP2024-17JanitorialService:Submittedby:ChristianInfante,Manager/OwnerSFMJanitorialServices,LLC.7500NW74AvenueMedley,FL33166Ph.305.818.2424x.I117Fx.305.818.3510SubmittedonThursday,January23,2025 1.TABLEOFCONTENTS1.TableofContents22.LetterofInterest43.ProposalFormPackage6PriceProposal234.FirmQualifications&Experience31WhyChooseSFM32Memberships33CapacitytoPerform34FinancialStability35Litigation36Licenses,Certifications,&Insurance375.References&PerformanceHistory41PublicEntityExperience48ReferenceLetters506.KeyPersonnelandQualifications55Resumes617.ApproachtoPerformtheServicesasRequested65OverallApproachtoAccountManagement65Web-BasedRestroomTechnology66EmergencyReponse71ManagementStructure72ProposedOrganizationalChart&Staffing73TransitionPlan74SFMTransitionTracker7560DayTransitionTimeline76PreliminaryImplementationPlan77I.ImplementationTeam77II.ExpectationsMeeting78III.OnSiteOrientation78IV.OrderEquipment&Supplies79ProposedEquipmentPlan79V.EmployeeScreening&Hiring80PlanstoInterviewIncumbentStaff80VI.EmployeeTraining82VILSetUpWeb-basedQualityControlInspectionSystem82VIII.Invoicing83fllSFM^111JanitorialPc^15^26 IX.ServiceStartUp83X.FollowUpMeetings848.Equipment,Chemicals,andProducts85SFMFleet85Suppliers86Chemicals87SafetyDataSheets"SDS"88MicrofiberTechnology89EquipmentList90FloorCare93SustainabilityandResiliencyStewardship959.Policies&Procedures97HumanResourcesProgram97SFM'sHiringFormat98EmployeeTracking98HiringMethodology99BackgroundChecks99EmployeeSatisfactionandRecognitionProgram100DrugFreeWorkplaceProgram101EmployeeIdentification&Uniforms102UKGTimeandAttendanceSystem10310.SafetyandTrainingProgram104TrainingCertifications10511.QualityAssurancePlan110ClientTicketSystem111MeasurementTools113ClientAnalytics113SFM'sInternalCommunicationSystem114InspectionReports11512.DistinctiveServicesOffered119EventCleaning120DisasterRecoveryServices121HighDisinfectionServices122CommunityInvolvement123(IISFM^11JanitorialPc^bo«^26 2.LETTEROFINTERESTThursday,January23,2025StevenP.KulickCityofSouthMiami6130SunsetDriveCityofSouthMiami,FL33143earMr.KulickandMembersoftheEvaluationCommittee,SFMJanitorialServices,LLC.,("SFM"),ispleasedtosubmitthisproposaltotheCityofSouthMiamiinresponsetoRFP2024-17"JanitorialServices".SFMisalocalMiami-DadeCounty,minority-certified,family-ownedbusinessheadquarteredintheTownofMedley,FLjust25minutesfromtheCityofSouthMiami.Thisstrategiclocationpositionsustoefficientlyallocateresources,ensuringpromptandreliableservicedeliveryforthecity.SFMcleansover8millionsquarefeetthroughoutSouthFlorida.Weoffergovernmentbuildings,municipalities,medicalfacilities,andcommercialbusinessesthenecessaryservicestomaintainacleanandsafeenvironmentforitsbusinesscommunityandresidents.Ourcompanyhasthevastexperience,talent,andpracticesofalargefirm,buttheserviceandareaknowledgeofalocalcompanydedicatedtoitsclientneeds.Enclosed,youwillfindinformationonourfirmthatwilldemonstratewhywearetherightchoiceforSouthMiami.Listedbelowareafewkeypointsfromourproposal.EmployeeBenefits4-Theminimumbudgetpayforalljanitorsinthiscontractis7.69%abovetheStateminimumwage.4-LifeinsuranceforallFTE'spaidforbySFM.4-Allstaffwillbeeligibleforperformancebonuses.4-Allstaffwillreceivefreeuniforms.eudsPublicBuildingCleaningSFMcurrentlyhasmunicipal/countyjanitorialcontractswith:4-CityofCoralGables4-CityofMiamiBeach4-Miami-DadeCounty4-CityofPompanoBeach4-TownofCutlerBay4-VillageofPalmettoBay4-CityofMiamiGardens4-CityofHialeah<||SFMWIIJanitorial QualityControl4-Web-basedQualityControl.4-Unannouncedinspections.!Real-timereporting.SafetyandTraining4-Full-timein-housecertifiedtrainer.4Unannouncedinspections.EmergencyResponse4-EquippedforDisasterRecovery.4-RapidHighDisinfectionCleaning.4-Emergencywaterextraction.4*GreenSealcleaningproducts4-Allcleaningproductsusedcompany-wideareGreenSealCertified.ThisisaSFMstandardpractice.Astheauthorizedrepresentativesofourfirm,Ihavetheauthoritytoenterintocontractsonitsbehalf.IhavecarefullyevaluatedyourRFPandcanassureyouthatSFMhastheexperience,personnel,equipment,andresourcestocarryouttheoperationsoutlinedinthescopeofservices.Workingtogether,SFMcandeliveryourobjectives.Isuggestadiscussionafteryourreviewofourproposaltoexplainouroperationplanindetailandgetyourvaluablefeedback.Ifthereareanyquestionsregardingthisproposal,pleasefeelfreetocallmedirectlyat305.525.9442oremailmeatcinfante(5)sfmservices.comRespectfullySubmitted,(tyiiatciMOnfawteManager&OwnerSFMJanitorialServices,LLC.<||SFM11JanitorialPc^S1^26 3.PROPOSALFORMPACKAGESECTION4PROPOSALFORMPACKAGEAsprovidedintheRFP,thefollowingitemsmustbeattachedtothisProposal:FORMSSTATUS,Form1-ProposalFormPackageAcknowledgementzForm2A.Proposer’sCertification(ifCompanyorCorporation)Form2B.Proposer'sCertification(ifPartnership)Form3.SingleExecutionAffidavits9ZForm4.DisputeDisclosureForm5.CertificationRegardingDebarment,Suspension,&OtherResponsibilityMattersPrimaryCoveredTransactionszForm6.Proposer’sQualificationsSurvey/Form7.PriceProposalFormForm8.ReferenceListForm9.KeyStaff&ProposedSubcontractorsATTACHMENTSThiscompetitivesolicitationincorporatesthefollowingattachments,whichshouldbereviewedthoroughlyand,ifapplicable,completedpriortosubmittingaresponsetothiscompetitivesolicitation.TheCityisattachingthefollowingAttachments:AttachmentA.AttachmentB.AttachmentC.AttachmentD.AttachmentE.SampleofProfessionalServicesAgreementDeclaration/AffidavitofRepresentationJanitorialServicesLocationsMatrixPhotographsofFloorTypesinServiceAreasBackgroundScreening,Chapter435,FloridaStatutes435.0426of92<||SFM11JanitorialPc^S FORM1PROPOSALFORMPACKAGEACKNOWLEDGEMENTSIherebyproposetofurnishthegoodsandservicesspecifiedintheRequestforProposals,RFPNo.FN2024-17.IagreethatmyProposalwillremainfirmforaperiodof180daysafteropenedbytheCityinordertoallowtheCityadequatetimetoevaluatetheProposal.IcertifythatallinformationcontainedinthisProposalistruthfultothebestofmyknowledgeandbelief.IfurthercertifythatIamdulyauthorizedtosubmitthisProposalonbehalfoftheFirmnamedastheProposingFirmandthatsaidFirmisready,willing,andabletoperformifawardedtheAgreement.1furthercertify,underoath,thatthisProposalismadewithoutpriorunderstanding,agreement,connection,discussion,orcollusionwithanyotherperson,firmorcorporationsubmittingaProposal;noofficer,employeeoragentoftheCityofSouthMiamioranyotherProposerhasaninterestinsaidProposal.Furthermore,IcertifythattheundersignedexecutedthisProposalFormwithfullknowledgeandunderstandingofmattersthereincontainedandwasdulyauthorized.IfurthercertifythattheProposeracknowledgesreceiptofallAddendaissuedbytheCityinconnectionwiththeRFP(Checktheboxnexttoeachaddendumreceived).XAddendum1Addendum6Addendum2Addendum7Addendum3Addendum8Addendum4Addendum9Addendum5Addendum10Attachedheretoarethefollowingforms/documentswhichformapartofthisProposal:Form1.ProposalFormPackageAcknowledgement.Form2A.Proposer’sCertification(ifCompanyorCorporation)Form2B.Proposer’sCertification(ifPartnership)Form3.SingleExecutionAffidavitsForm4.DisputeDisclosureForm5.CertificationRegardingDebarment.Suspension,&OtherResponsibilityMattersPrimaryCoveredTransactionsForm6.Proposer’sQualificationsSurveyForm7.PriceProposalFormForm8.ReferenceListForm9.KeyStaff&ProposedSubcontractors27of92(IlSFMIJanitoriolPcS/cPf15^26 FORM1PROPOSALFORMPACKAGEACKNOWLEDGEMENTS(CONTINUED)SFMJanitorialServices.LLC.NAMEOFPROPOSERFIRMSIGNATI•FPROPOSERChristianInfante.ManagerNAME&TITLE.TYPEDORPRINTEDMAILINGADDRESS7500NW74AvenueMedley.FL33166(3O5_)818.2424x.1117TELEPHONENUMBERStateofFloridaCountyofMiami-DadeTheforegoinginstrumentwasacknowledgedbeforemebymeansofXphysicalpresenceor_onlinenotarization,this20thdayofJanuars.2025,byChristianInfante(nameofperson)asManagerOwner(typeofauthority)Jpf,SFMJanitorialServices.LLC.(nameofpartyonbehalf/rfwhominstrumentisexecuted).XDidtakeanoath;orDidnottakeanoathXPersonallyknowntome;orProducedidentification(TypeofIdentification:NACommissioned)Ntfyar^Public(Print,Stamp,orType®^28of92 FORM2APROPOSER’SCERTIFICATION(ifCompanyorCorporation)CERTIFICATESTATEOFFLORIDA))SSCOUNTYOFMIAMI-DADE)1HEREBYCERTIFYthatameetingoftheBoardofDirectorsofSFMJanitorialServices,LLC.acorporationorcompanyexistingunderthelawsoftheStateofFlorida,heldonJanuary2O'h,,2025,thefollowingresolutionwasdulypassedandadopted:RESOLVED,that,ChristianInfanteasManageroftheCorporation/Company,beandisherebyauthorizedtoexecutetheProposaldated,January20lh,2025totheCityofSouthMiamiforRFPNo.FN2024-17“JanitorialServices,”andthatthisexecutionthereof,attestedbytheSecretaryoftheCorporation/Company,andwiththeCorporate/CompanySealaffixed,shallbetheofficialactanddeedofthisCorporation/Company.Ifurthercertifythatsaidresolutionisnowinfullforceandeffect.INWITNESSWHEREOF,Ihavehereuntosetmyhandandaffixedtheofficialsealofcorporation/companyonthisthe20lh(SEAL)29of92(IISFMIIJanitorial FORM2BPROPOSER’SCERTIFICATION(ifPartnership)NOTAPPLICABLECERTIFICATESTATEOF))SSCOUNTYOF)IHEREBYCERTIFYthatameetingofthePartnersof,apartnershipexistingunderthelawsoftheStateof,heldon,2024,thefollowingresolutionwasdulypassedandadopted:"RESOLVED,that,asofthePartnership,beandisherebyauthorizedtoexecutetheProposaldated,2024,totheCityofSouthMiamiforRFPNo.FN2024-17JanitorialServicesfromthispartnershipandthathisexecutionofthereof,attestedbytheshallbetheofficialactanddeedofthisPartnership."Ifurthercertifythatsaidresolutionisnowinfullforceandeffect.INWITNESSWHEREOF,Ihavehereuntosetmyhandthis,dayof2024.Secretary(SEAL)30of92Pa^qt1^|8126(IlSFMIIJanitorial FORM3SINGLEEXECUTIONAFFIDAVITSTHISFORMMlslBESIGXKDKSD^UORSIOIXIHFI'RF''IMIOFAXOI\R\PlBl.ICOR01HER01Fill\lMIHORI7FDTOMIMIXIMEROAIHs.THISFORMCOMBINESSEVERALAFFIDAVITSTATEMENTSTOBESWORNTOBYTHEPROPOSERORPROPOSERANDNOTARIZEDBELOW.INTHEEVENTTHEPROPOSERORPROPOSERCANNOTSWEARTOANYOFTHESEAFFIDAVITSTATEMENTS,THEPROPOSERORPROPOSERISDEEMEDTOBENON¬RESPONSIBLEANDISNOTELIGIBLETOSUBMITAPROPOSAL/PROPOSAL.THESESINGLEEXECUTIONAFFIDAVITSARESUBMITTEDTOTHECITYOFSOUTHMIAMIANDARESTATEMENTSMADE:By:ChristianInfanteFor(NameofProposingorBiddingEntity):SFMJanitorialServices,LLC.Whosebusinessaddressis:7500NW74AvenueMedley,FL33166And(ifapplicable)itsFederalEmployerIdentificationNumber(FEIN)is:20-4908937(iftheentitydoesnothaveanFEIN,includetheSocialSecurityNumberoftheindividualsigningthisswornstatement.SS#:)AmericanswithDisabilitiesActComplianceAffidavitTheabovenamedfirm,corporationororganizationisincompliancewithandagreestocontinuetocomplywith,andassurethatanysubcontractor,orthirdpartycontractorunderthisprojectcomplieswithallapplicablerequirementsofthelawslistedbelowincluding,butnotlimitedto,thoseprovisionspertainingtoemployment,provisionofprogramsandservices,transportation,communications,accesstofacilities,renovations,andnewconstruction.•TheAmericanwithDisabilitiesActof1990(ADA),Pub.L.101-336,104Stat327,42USC1210112213and47USCSections225and661includingTitle1,Employment;TitleII,PublicServices;TitleIII,PublicAccommodationsandServicesOperatedbyPrivateentities;TitleIV,Telecommunications;andTitleV,MiscellaneousProvisions.•TheFloridaAmericanswithDisabilitiesAccessibilityImplementationActof1993,Section553.501-553.513.FloridaStatutes:•TheRehabilitationActof1973,229USCSection794;•TheFederalTransitAct,asamended49USCSection1612;•TheFairHousingActasamended42USCSection3601-3631.Propd^rInitials/L131of92<||SFM^11JanitorialPa^<|f|1<5l8126 PublicEntityCrimesAffidavitIunderstandthata"publicentitycrime"asdefinedinParagraph287.133(I)(g),FloridaStatutes,meansaviolationofanystateorfederallawbyapersonwithrespecttoanddirectlyrelatedtothetransactionofbusinesswithanypublicentityorwithanagencyorpoliticalsubdivisionofanyotherstateoroftheUnitedStates,includingbutnotlimitedto,anyProposalorcontractforgoodsorservicestobeprovidedtoanypublicentityoranagencyorpoliticalsubdivisionofanyotherstateoroftheUnitedStatesandinvolvingantitrust,fraud,theft,bribery,collusion,racketeering,conspiracy,ormaterialmisrepresentations.Iunderstandthat"convicted"or"conviction"asdefinedinParagraph287.133(I)(b).FloridaStatutes,meansafindingofguiltoraconvictionofapublicentitycrime,withorwithoutanadjudicationofguilt,inanyfederalorstatetrialcourtofrecordrelatingtochargesbroughtbyindictmentorinformationafterJuly1,1989,asaresultofajuryverdict,non-jurytrial,orentryofapleaofguiltyornolocontendere.Iunderstandthatan“affiliate"asdefinedinParagraph287.133(1)(a),FloridaStatutes,means:1.Apredecessororsuccessorofapersonconvictedofapublicentitycrime;or2.Anentityunderthecontrolofanynaturalpersonwhoisactiveinthemanagementoftheentityandwhohasbeenconvictedofapublicentitycrime.Theterm“affiliate"includesthoseofficers,directors,executives,partners,shareholders,employees,members,andagentswhoareactiveinthemanagementofanaffiliate.Theownershipbyonepersonofsharesconstitutingacontrollinginterestinanotherperson,orapoolingofequipmentorincomeamongpersonswhennotforfairmarketvalueunderanarm'slengthagreement,shallbeaprimafaciecasethatonepersoncontrolsanotherperson.ApersonwhoknowinglyentersintoajointventurewithapersonwhohasbeenconvictedofapublicentitycrimeinFloridaduringthepreceding36monthsshallbeconsideredanaffiliate.Iunderstandthata“person"asdefinedinParagraph287.133(1)(e),FloridaStatutes,meansanynaturalpersonorentityorganizedunderthelawsofanystateoroftheUnitedStateswiththelegalpowertoenterintoabindingcontractandwhichproposalsorappliestoProposaloncontractsfortheprovisionofgoodsorservicesletbyapublicentity,orwhichotherwisetransactsorappliestotransactbusinesswithapublicentity.Theterm"person"includesthoseofficers,directors,executives,andpartners,shareholders,employees,members,andagentswhoareactiveinmanagementofanentity.Basedoninformationandbelief,thestatement,whichIhavemarkedbelow,istrueinrelationstotheentitysubmittingthisswornstatement.(INDICATEWHICHSTATEMENTAPPLIES.)SNeithertheentitysubmittingthisswornstatement,noranyofitsofficers,directors,executives,partners,shareholders,employees,members,oragentswhoareactiveinthemanagementoftheentity,noranyaffiliateoftheentityhasbeenchargedwithadconvictedofapublicentitycrimesubsequenttoJuly1,1989.Theentitysubmittingthisswornstatement,oroneormoreofitsofficers,directors,executives,partners,shareholders,employees,members,oragentswhoareactiveinthe32of92Pa^26<||SFM”11Janitorial managementoftheentity,oranaffiliateoftheentityhasbeenchargedwithandconvictedofapublicentitycrimesubsequenttoJuly1,1989.Theentitysubmittingthisswornstatement,oroneormoreofitsofficers,directors,executives,partners,shareholders,employees,members,oragentswhoareactiveinthemanagementoftheentity,oranaffiliateoftheentityhasbeenchargedwithandconvictedofapublicentitycrimesubsequenttoJuly1,1989.However,therehasbeenasubsequentproceedingbeforeaHearingOfficeroftheStateofFlorida,DivisionofAdministrativeHearingsandthefinalOrderenteredbytheHearingOfficerdeterminedthatitwasnotinthepublicinteresttoplacetheentitysubmittingthisswornstatementontheconvictedvendorlist(attachacopyofthefinalorder).Iunderstandthatthesubmissionofthisformtothecontractingofficerforthepublicentityidentifiedinparagraph1aboveisforthatpublicentityonlyandthatthisformisvalidthroughDecember31ofthecalendaryearinwhichitisfiled.Ialsounderstandthat1amrequiredtoinformthepublicentitypriortoenteringintoacontractinexcessofthethresholdamountprovidedinSection287.017,FloridaStatutesforcategorytwoofanychangeintheinformationcontainedinthisform.PrqepsgtrlnitialsNoConflictofInterestorContingentFeeAffidavitProposerwarrantsthatneitheritnoranyprincipal,employee,agent,representativenorfamilymemberhaspaidorwillpayanyfeeorconsiderationthatiscontingentontheawardorexecutionofacontractarisingoutofthissolicitation.Proposeralsowarrantsthatneitheritnoranyprincipal,employee,agent,representativenorfamilymemberhasprocuredorattemptedtoprocurethiscontractinviolationofanyoftheprovisionsoftheMiami-DadeCountyandCityofSouthMiamiconflictofinterestorcodeofethicsordinances.Further,ProposeracknowledgesthatanyviolationofthesewarrantswillresultintheterminationofthecontractandforfeitureoffundspaidortobepaidtotheBroposershouldtheProposerbeselectedfortheperformanceofthiscontract.TjnitialsBusinessEntityAffidavitProposerherebyrecognizesandcertifiesthatnoelectedofficial,boardmember,oremployeeoftheCityofSouthMiami(the"City”)shallhaveafinancialinterestdirectlyorindirectlyinthistransactionoranycompensationtobepaidunderorthroughthistransaction,andfurther,thatnoCityemployee,noranyelectedorappointedofficer(includingCityboardmembers)oftheCity,noranyspouse,parentorchildofsuchemployeeorelectedorappointedofficeroftheCity,maybeapartner,officer,directororproprietorofProposerorVendor,andfurther,thatnosuchCityemployeeorelectedorappointedofficer,orthespouse,parentorchildofanyofthem,aloneorincombination,mayhaveamaterialinterestintheVendororProposer.Materialinterestmeansdirectorindirectownershipofmorethan5%ofthetotalassetsorcapitalstockoftheProposer.AnyexceptiontotheseabovedescribedrestrictionsmustbeexpresslyprovidedbyapplicablelaworordinanceandbeconfirmedinwritingbyCity.Further,ProposerrecognizesthatwithrespecttothistransactionorProposal,ifanyProposerviolatesorisapartytoaviolationoftheethics33of92Pa^qfe1<5l81264IISFMIIJanitorial ordinancesorrulesoftheCity,theprovisionsofMiami-DadeCountyCodeSection2-11.1,asapplicabletoCity,ortheprovisionsofChapter112,partIII,Fla.Stat.,theCodeofEthicsforPublicOfficersandEmployees,suchProposermaybedisqualifiedfromfurnishingthegoodsorservicesforwhichtheProposalorProposalissubmittedandmaybefurtherdisqualifiedfromsubmittinganyfutureproposalsorProposalforgoodsorservicestoCity.PropojAnti-CollusionAffidavit1.Proposer/ProposerhaspersonalknowledgeofthematterssetforthinitsProposal/ProposalandisfullyinformedrespectingthepreparationandcontentsoftheattachedProposal/ProposalandallpertinentcircumstancesrespectingtheProposal/Proposal;2.TheProposal/ProposalisgenuineandisnotacollusiveorshamProposal/Proposal;and3.NeithertheProposer/Proposernoranyofitsofficers,partners,owners,agents,representatives,employees,orpartiesininterest,includingAffiant,hasinanywaycolluded,conspired,connived,oragreed,directlyorindirectlywithanyotherProposerProposer,firm,orpersontosubmitacollusiveorshamProposal/Proposal,orhasinanymanner,directlyorindirectly,soughtbyagreementorcollusionorcommunicationorconferencewithanyotherProposer/Proposer,firm,orpersontofixthepriceorpricesintheattachedProposal/ProposalorofanyotherProposer/Proposer,ortofixanyoverhead,profit,orcostelementoftheProposal/ProposalpriceortheProposal/ProposalpriceofanyotherProposer/Proposer,ortosecurethroughanycollusion,conspiracy,connivanceorunlawfulagreementanyadvantageagainsttheCityoranypersoninterestedintheproposedContractScrutinizedCompanyCertification1.ProposercertifiesthatitanditssubcontractorsarenotontheScrutinizedCompaniesthatBoycottIsraelList.PursuanttoSection287.135,F.S..theCitymayimmediatelyterminatetheAgreementthatmayresultfromthisRFPatitssoleoptioniftheProposeroritssubcontractorsarefoundtohavesubmittedafalsecertification;oriftheProposer,oritssubcontractorsareplacedontheScrutinizedCompaniesthatBoycottIsraelListorisengagedintheboycottofIsraelduringthetermoftheAgreement.2.IftheAgreementthatmayresultfromthisRFPisformorethanonemilliondollars,theProposercertifiesthatitanditssubcontractorsarealsonotontheScrutinizedCompanieswithActivitiesinSudan,ScrutinizedCompanieswithActivitiesintheIranPetroleumEnergySectorList,orengagedwithbusinessoperationsinCubaorSyriaasidentifiedinSection287.135,F.S.pursuanttoSection287.135,F.S.,theCitymayimmediatelyterminatetheAgreementthatmayresultfromthisRFPatitssoleoptioniftheProposer,itsaffiliates,oritssubcontractorsarefoundtohavesubmittedafalsecertification;oriftheProposer,itsaffiliates,oritssubcontractorsareplacedontheScrutinizedCompanieswithActivitiesinSudanList,or34of92Pa^Qt|1<fPl26 ScrutinizedCompanieswithActivitiesintheIranPetroleumEnergySectorList,orengagedwithbusinessoperationsinCubaorSyriaduringthetermoftheAgreement3.TheProposeragreestoobservetheaboverequirementsforapplicablesubcontractsenteredintofortheperformanceofworkundertheAgreementthatmayresultfromthisRFPAsprovidedinSubsection287.135(8),F.S.,iffederallawceasestoauthorizetheabove-statedcontractingprohibitionsthentheyshallbecomeinoperative.Drug-FreeWorkplaceAffidavitProposerherebyrecognizesthat,pursuanttoF.S.§287.087.preferenceshallbegiventobusinesseswithdrug-freeworkplaceprogramswhentwoproposalsProposalareequalwithrespecttoprice,quality,andservice.Proposerunderstandsthatinordertoqualifyasadrug-freeworkplace.Proposermust:a)Publishastatementnotifyingemployeesthattheunlawfulmanufacture,distribution,dispensing,possession,oruseofacontrolledsubstanceisprohibitedintheworkplaceandspecifyingtheactionsthatwillbetakenagainstemployeesforviolationsofsuchprohibition.b)Informemployeesaboutthedangersofdrugabuseintheworkplace,theProposer'spolicyofmaintainingadrug-freeworkplace,anyavailabledrugcounseling,rehabilitation,andemployeeassistanceprograms,andthepenaltiesthatmaybeimposeduponemployeesfordrugabuseviolations.1)GiveeachemployeeengagedinprovidingcommoditiesorcontractualservicesundertheRFPacopyofthestatementspecifiedinsubsection(1).2)Notifyemployeesthat,asaconditionofworkingonthecommoditiesorcontractualservicesundertheRFP,theemployeemustabidebythetermsofthestatementandwillnotifytheemployerofanyconvictionof,orpleaofguiltyornolocontendereto,anyviolationofchapter893orofanycontrolledsubstancelawoftheUnitedStatesoranystate,foraviolationoccurringintheworkplacenolaterthanfive(5)daysaftersuchconviction.3)Imposeasanctionon,orrequirethesatisfactoryparticipationinadrugabuseassistanceorrehabilitationprogramifsuchisavailableintheemployee'scommunity,byanyemployeewhoissoconvicted.4)Makeagoodfaithefforttocontinuetomaintainadrug-freeworkplacethroughtheimplementationofthissection.Basedoninformationandbelief,thestatement,whichIhavemarkedbelow,istrueinrelationstotheentitysubmittingthisswornstatement.(INDICATEWHICHSTATEMENTAPPLIES.)XTheentitysubmittingthisswomstatementisadrug-freeworkplaceandisinfull35of92<||SFM^11JanitorialPa^qfeWl26 compliancewiththerequirementssetforthunderF.S.§287.087.Theentitysubmittingthisswornstatementisnotadrug-freeworkplace.Pro|&S6rInitialsCityNon-DiscriminationRequirementsAffidavitProposerunderstandsthatpursuanttoSection3-1.1oftheCodeoftheCityofSouthMiami,theCitywillnotenterintoorawardacontracttoanentityengagedinaboycott.Proposerunderstandsthat"Boycott"asdefinedunderSection3-1.1oftheCodeoftheCityofSouthMiamimeanstoblacklist,divestfrom,orotherwiserefusetodealwithanationorcountry,ortoblacklistorotherwiserefusetodealwithapersonorentitywhentheactionisbasedonrace,color,nationalorigin,religion,sex,genderidentity,sexualorientation,maritalorfamilialstatus,age,ordisabilityinadiscriminatorymanner.Thetermboycottdoesnotincludeadecisionbaseduponbusinessoreconomicreasons,orboycotts,embargoes,traderestrictions,ordivestmentsthatarespecificallyauthorizedorrequiredbyfederallaworstatelaw.Proposercertifiesthatitisnotengagedinaboycott,andisinfullcompliancewithSection3-1.1oftheCod*oftheCityofSouthMiami.PropterInitialsAcknowledgment,Warranty,andAcceptance1.ContractorwarrantsthatitiswillingandabletocomplywithallapplicablestateofFloridalaws,rulesandregulations.2.Contractorwarrantsthatithasread,understands,andiswillingtocomplywithallrequirementsofRFPNo,FN2024-03andanyaddendum/addendarelatedthereto.3.ContractorwarrantsthatitwillnotdelegateorsubcontractitsresponsibilitiesunderanagreementwithoutthepriorwrittenpermissionoftheCityCommissionorCityManager,asapplicable.4.ContractorwarrantsthatallinformationprovidedbyitinconnectionwiththisProposalistrueandaccurate.Pro/oj^r/Tnitials£"/(REMAINDEROFPAGELEFTINTENTIONALLYBLANK./SIGNATUREPAGEFOLLOWS.)36of92(IISFM”11Janitorial26 StateofFloridaCountyofMiami-DadeTheforegoinginstrumentwasacknowledgedbeforemebymeansofXphysicalpresenceor_onlinenotarization,this20thdayofJanuary.2025.byChristianInfanteXPersonallyknowntome;orO(nameofperson)asManagerOwner(typeofauthority)forSFMJanitorialSenices.LLC(nameofpartyonbehalfof\yhominstrumentisexecuted).ublic(Print,Stamp,orTypeas/'.Commissioned)<Producedidentification(TypeofIdentification:N/AXDidtakeanoath;orDidnottakeanoath-Vanezza0Riverar-A>ivCommissionQ37of92(IISFMWIIJanitorialPa^q^1^|8l26 FORM4DISPUTEDISCLOSUREAnswerthefollowingquestionsbyplacingan“X”after“Yes"or"No”.Ifyouanswer“Yes”,pleaseexplaininthespaceprovided,oronaseparatesheetattachedtothisform.1.Hasyourfirmoranyofitsofficers,receivedareprimandofanynatureorbeensuspendedbytheDepartmentofProfessionalRegulationsoranyotherregulatoryagencyorprofessionalassociationswithinthelastfive(5)years?YESNOX2.Hasyourfirm,oranymemberofyourfirm,beendeclaredindefault,terminatedorremovedfromacontractorjobrelatedtotheservicesyourfirmprovidesintheregularcourseofbusinesswithinthelastfive(5)years?NOXYES3.Hasyourfirmhadagainstitorfiledanyrequestsforequitableadjustment,contractclaims.Proposalprotests,orlitigationinthepastfive(5)yearsthatisrelatedtotheservicesyourfirmprovidesintheregularcourseofbusiness?YESNOXIfyes,statethenatureoftherequestforequitableadjustment,contractclaim,litigation,orprotest,andstateabriefdescriptionofthecase,theoutcomeorstatusofthesuitandthemonetaryamountsofextendedcontracttimeinvolvedIherebycertifythatallstatementsmadearetrueandagreeandunderstandthatanymisstatementormisrepresentationoffalsificationoffactsshallbecauseforforfeitureofrightsforfurtherconsiderationofthisProposalorProposalfortheCityofSouthMiami.ACKNOWLEDGMENTStateofFloridaCountyofMiami-DadeTheforegoinginstrumentwasacknowledgedbeforemebymeansofSphysicalpresenceoronlinenotarization,this2O'hdayofJanuary.2025by(hnstianInfante(nameofperson)asManagerOwner(typeofauthority)forSFMJanitorialServices.LLC,(nameofpartyonbehalfofwhominstrumentisexecuted).r\fIPersonallyknowntome;orProducedidentification(TypeofIdentification;NDidtakeanoath;orDidnottakeanoath38of92Pa^%qfe1<f|8126 FORM5CERTIFICATIONREGARDINGDEBARMENT,SUSPENSION,ANDOTHERRESPONSIBILITYMATTERSPRIMARYCOVEREDTRANSACTIONSThiscertificationisrequiredbytheregulationsimplementingExecutiveOrder12549,DebarmentandSuspension,13CFRPart145.TheregulationswerepublishedasPartVIIoftheMay26,1988FederalRegister(pages19160-19211).CopiesoftheregulationsareavailablefromlocalofficesoftheU.S.SmallBusinessAdministration.(1)Theprospectiveprimaryparticipantcertifiestothebestofitsknowledgeandbeliefthatitanditsprincipals:(a)Arenotpresentlydebarred,suspended,proposedfordisbarment,declaredineligible,orvoluntarilyexcludedfromcoveredtransactionsbyanyFederaldepartmentoragency;(b)Havenotwithinathree-yearperiodprecedingthisapplicationbeenconvictedoforhadaciviljudgmentrenderedagainstthemforcommissionoffraudoracriminaloffenseinconnectionwithobtaining,attemptingtoobtain,orperformingapublic(Federal,State,orlocal)transactionorcontractunderapublictransaction;violationofFederalorStateantitruststatutesorcommissionofembezzlement,theft,forgery,bribery,falsificationordestructionofrecords,makingfalsestatements,orreceivingstolenproperty;(c)Arenotpresentlyindictedfororotherwisecriminallyorcivillychargedbyagovernmentalentity(Federal,State,orlocal)withcommissionofanyoftheoffensesenumeratedinparagraph(1)(b)ofthiscertification;and(d)Havenotwithinathree-yearperiodprecedingthisapplicationhadoneormorepublictransactions(Federal,State,orlocal)terminatedforcauseordefault.(2)Wheretheprospectiveprimaryparticipantisunabletocertifytoanyofthestatementsinthiscertification,suchprospectiveprimaryparticipantshallattachanexplanationtothisStatementofQualifications.BusinessNameSFMJanitorialServices.LLC.Date01/20'2025SignatureofAuthorizedRepresentati\eChristianInfante.ManagerNameandTitleofAuthorizedRepresentative39of92<||SFM^11Janitorial FORM6PROPOSER’SQUALIFICATIONSSURVEYCOMPANYQUALIFICATIONSQUESTIONNAIREPleasecompletethisCompanyQualificationsQuestionnaire.BycompletingthisformandsubmittingaresponsetotheRFP,youcertifythatanyandallinformationcontainedintheProposalistrue,thatyourresponsetotheRFPismadewithoutpriorunderstanding,agreement,orconnectionswithanycorporation,firmorpersonsubmittingaresponsetotheRFPforthesamematerials,supplies,equipment,orservices,isinallrespectsfairandwithoutcollusionorfraud,thatyouagreetoabidebyalltermsandconditionsoftheRFP,andcertifythatyouareauthorizedtosignfortheProposer'sFinn.Someresponsesmayrequiretheinclusionofseparateattachments.Separateattachmentsshouldbeasconciseaspossible,whileincludingtherequestedinformation.InnoeventshouldthetotalpagecountofallattachmentstothisFormexceedfive(5)pages.Someinformationmaynotbeapplicable:insuchinstances,pleaseinsert"N/A".SFMJanitorialServices,LLC.FirmName7500NW74AvenueMedley,FL33166PrincipalBusinessAddress305.818.2424305.818.3510TelephoneNumberFacsimileNumbereinfanteusfmservices.comEmailAddress20-4908937FederalI.D.No.orSocialSecurityNumberTomiofMedleyBTAX25-2639,Miami-DadeCounty3101375MunicipalBusinessTax/OccupationalLicenseNo.FIRMHISTORYANDINFORMATIONHowmanyyearshasthefirmhasbeeninbusinessunderitscurrentnameandownership?18-PleaseidentifytheFirm'sdocumentnumberwiththeFloridaDivisionofCorporationsanddatetheFirmregistered/filedtoconductbusinessintheStateofFlorida:L0600004772205092006DocumentNumberDateFiledPleaseidentifytheFirm'scategorywiththeFloridaDepartmentofBusinessProfessionalRegulation(DBPR),DBPRlicensenumber,anddatelicensedbyDBPR:NACategoryLicenseNo.DateLicensed40of92Pa§^2t1<fPl26(IlSFMWIIJanitorial PleaseindicatethetypeofentityformoftheFirm(ifother,pleasedescribe):IndividualPartnershipCorporationXLLCLLPOtherPleaseidentifytheFinn'sprimarybusiness:7500NW74AvenueMedley.FL33166PleaseidentifythenumberofcontinuousyearsyourFirmhasperformeditsprimarybusiness:50+PleaselistallprofessionallicensesandcertificationsheldbytheFirm,itsQualifier/Principal,andanyKeyStaff,includinganyactivecertificationsofsmall,minority,ordisadvantagedbusinessenterprise,andthenameoftheentitythatissuedthelicenseorcertification:NALicense/CertificationTypeNameofEntityIssuingLicenseorCertificationLicenseNo.LicenseIssuanceDatePleaseidentifythename,licensenumber,andissuancedateofanypriorcompaniesthatpertaintoyourFitm:NALicense/CertificationTypeNameofEntityIssuingLicenseorCertificationLicenseNo.LicenseIssuanceDatePleaseidentifyallindividualsauthorizedtosignfortheentity,theirtitle,andthethreshold/leveloftheirsigningauthority:AuthorizedSignor'sNameTitleSigningAuthorityThreshold(All,Costupto$X-Amount,NoCost,Other)ChristianInfanteManagerALLJoseInfanteFounderALLPleaseidentifythetotalnumberofFirmemployees,managerial/administrativeemployees,andidentifythetotalnumberoftradesemployeesbytrade(e.g.,20electricians.5laborers,2INSURANCEINFORMATIONPleaseprovidethefollowinginformationabouttheFirm'sinsurancecompany:TotalNo.ofEmployees487TotalNo.ofManagerial/AdministrativeEmployees15TotalNo.ofTradesEmployeesbyTradeOldRepublicInsuranceCompanyUSIInsuranceServices:JoseSardinasInsuranceCarrierNameInsuranceCarrierContactPerson41of92Pait3f|1<5l8126|||SFM^111Janitorial 201AlhambraCircle.Suite1205CoralGables.FL33134;786.427,5982;Jose.Sardinasf^USI.comInsuranceCarrierAddressTelephoneNo.EmailHastheFirmfiledanyinsuranceclaimsinthelastfive(5)years?(XNoYesIfyes.pleaseidentifythetypeofclaimandtheamountpaidoutundertheclaim:FIRMOWNERSHIPPleaseidentifyallFirmownersorpartners,theirtitle,andpercentofownership:Owner/PartnerNameTitleOwnership(%)SFMServicesInc.MGRM100%Pleaseidentifywhetheranyoftheowners/partnersidentifiedaboveareowners/partnersinanotherentity:NosYesIfyes.pleaseidentifythenameoftheowner/partner.theotherentity'sname,andpercentofownershipheldbythestatedowner/partner:Owner/PartnerNameOtherEntityNameOwnership(%)SFMServicesInc.SFMLandscapeScrvces.LLC.100%RECENTCONTRACTSPleaseidentifythefive(5)mostrecentcontractsinwhichyourFinnhasprovidedservicestootherpublicentities:PublicEntityNameContactPersonTelephoneNo.EmailAddressDateAwardedCityofCoralGablesRalphRodriguez305.460.5014RRodriguez1(acoralgajles.comYR:2021CityofHialeahLuisSuarez305.883.598Xlasuarezf«hialeahfl.grvYR:2024CityofMiamiBeachElizabethMiro305.673.7000elizabethniiro(hmiamileachfl.govYR:2019TownofCutlerBayVivianManach786.573.5504VManachfhcutlerbay-ll.govYR:2023VillageofPalmettoBiyKarlaMorales786.354.5546kmorales^palmettobaj-fl.govYR:2022Bysigningbelow.ProposercertifiesthattheinformationcontainedhereiniscompleteandaccuratetothebestofProposer’sknowledge.Firm:SFMJanitorialServices.LLC.AuthorizedSignature:/~PrintorTypeName:ChpstianNnfanteDate:01/20/2025Title:Manager42of92(IISFMWIIJanitorial PRICEPROPOSALFORM7PRICEPROPOSALPricingshallbesubmittedinaccordancewiththeScopeofServices,Section3.NOTE:OVERTHETERMOFTHEAGREEMENT,THECITYRESERVESTHERIGHTTOADDORDELETESERVICEAREAS,DEPENDINGUPONCONDITIONS.INTHOSECASES,THEANNUALFEEWILLBEADJUSTEDUSINGTHE“SCHEDULEOFVALUES”MATRIXBELOW.A.ANNUALFEEYEARANNUALFEEYear1s2.^.00Y'ear2$\M4.Hco.00Year3>Year4(OptionYear),,_oosus^nno.Year5(OptionYear)s00TOTAL—.,—,eoB.SCHEDULEOFVALUESFORTHEANNUALFEESylvaMartinandPorch;CityHall(1“&2"'1Floor):PoliceDepartment(Iu&2"JFloor)CommunityCenter(Multi-Purpose.Arts&CraftsComputerLab&EducationRoom)IndoorBasketballGymnasium/Bleacherss$MarshallWilliamsonbuilding.commonlyknownasMobleybuildingoos43of92Pa|%261<f|8l26<||sm^11Janitorial SeniorCitizensCentersPublicWorks1sDanteFascellPark©os3,3AuthorizedSignature:PrintorTypeName:tanInlanteFinn:SIMJanitorialSenices.IDate:0120202<Title:Manage,44of92(IISFM^11JanitorialPa|4:26|1<f|8l26 FORM8REFERENCELISTINADDITIONTOTHEINFORM\IIONREQUIREDON1HISFORM.PROPOSERSHALLPROVIDEAMINIMIMOFFOUR(4)REFERENCLLETTERSREFERENCE#1PublicEntityName:CityofCoralGablesReferenceContactPerson/Title/Department:RalphRodriguez,Chief,GeneralSenice.sAdministrationDisisionContactNumber&Email305,460.5014;rrodriguez.I(<rcoraluables.comPublicEntitySizc/NumberofResidents/SquareMileage:Approx.250,000sq.ft.Event(s)Completed(includeNameofProject/Event.DateofEventStart/Completion,DetailsonSize/ScopeofWork/Complexity)SFMcurrentlypresidesjanitorialservicestoallCityownedfacilitiesincludingnightlycleaningofoffices,restrooms,commonareas.Dailyportersenicestorestroomsandcommonareas,carpelcleaning,stripping&refmishingfloors,highpressurecleaning,electrostaticdisinfectionservices.andotherspecialcleaningsenicesSFMcleansapproximately12sitesinthiscontract.SFMalsoperformsSpecialEventCleaning.IstheContractstillActive?YesxNo45of92(IISFM^11JanitorialPa§5«61(50126 REFERENCE#2PublicEntityName:CitvofMiamiBeachReferenceContactPerson/Title/Department:ElizabethMiro,InterimDirector,FacilitiesandFleetMgt.Dept.ContactNumber&Email305.673.7000.x22025:elizabelhmirotamiamibcachll.posPublicEntitySize/NumberofResidents/SquareMileage:Approx.2.4millionsqttEvent(s)Completed(includeNameofProject/Event,DateofEventStart/Completion,DetailsonSize/ScopcofWork/Complcxity)SFMcurrentlyprovidesjanitorialservicesthroughouttheCityatallcityownedfacilities,parkinggarages,publicrestrooms,andparkrestrooms.SFMcleansapproximately63sitesinthiscontract.SFMalsoperformsSpecialEventCleaning.IstheContractstillActive?YesXNo46of92<||SFM^11JanitorialPai&2fc1<5|8l26 REFERENCE#3PublicEntityName:TownofCutlerBayReferenceContactPerson/Title/Department:VivianManachAdministrativeServicesDirector.DepartmentofAdministrativeServicesContactNumber&EmailPublicEntitySize/NumberofResidents/SquareMileage:Approx22,Sh2ksqft.Event(s)Completed(includeNameofProject/Event,DateofEventStart/Completion,DetailsonSize/ScopeofWork/Complexity)SI'Mcurrentlyprovidesjanitorialservicesandnightlycleaningofoffices.andcommonareasofTownHallOfficesIstheContractstillActive?YesXNo47of92<||SFM”11JanitorialPa§£26 REFERENCE#4PublicEntityName:CityofHialeahReferenceContactPerson/Title/Department:IuhSuarez,PurchasingManager,PurchasingDeptContactNumber&Email305.883.598X;lasuarez«hialeahll.govPublicEntitySize/NumberofResidents/SquarcMileage:Approx.870ksqftEvent(s)Completed(includeNameofProject/Event,DateofEventStart/Completion,DetailsonSize/ScopeofWork/Complexity)SFMcurrentlyprovidesjanitorialservicestoallcityownedfacilitiesandparksincludingnightlycleaningofoffices,restrooms,andcommonareas.AdditionalServicessuchas-carpetcleaning,stripping&refinishingfloors,high-pressurecleaning,degreasingofconcretefloors,waterextraction,graffitiremoval,cleaningofcanopiesawnings,andotherspecialcleaningservicesarealsoperformedIstheContractstillActive?YesXNo48of92(IlSFM^■11JonitoriolPa|^561<5|812« FORM9KEYSTAFF&PROPOSEDSUBCONTRACTORSKEYSTAFFPleasecompletethefollowingchartwiththeFirm’sproposedKeyStaff.Ifadditionalspaceisrequired,pleasecopy/duplicatethispageandattachtothisForm.Additionalspace:raNoYesNameTitleYearsofExperienceYearswithFirmLicenses/CcrtiflcationsTBDAccouniManagerTBDTBDTBDPascaleLope/GeneralManager10-10-Enclosedinproposal.AlejandroDiColaProjectManager(floorCare/Npcvi.ilPnytxii)7-7‘Enclosedinproposal.IsraelRosadocoo25<2tNAPleaseexplaintheFirm’sabilityandresourcestosubstitutepersonnelwithequalorhigherqualificationsthantheKeyStafftheywillsubstituteforwheresubstituteisrequiredduetoattrition,turnover,oraspecificrequestbytheCity:Pleaserefertothesectiontitled"HumanResources"inourproposal49of92flSFMWIIJanitorial PleaseidentifyeachKeyStaffmember'sengagementcommitmentsthatwillexistconcurrentlywiththeCity’sServices:KeyStaffNameAreaofResponsibilityClientCommitment(Hours/week)PeriodofEngagementTBDTBDTBDTBDTBDPROPOSEDSUBCOXTRACTORSTheundersignedProposerherebydesignates,asfollows,allmajorsubcontractorswhomtheyproposetoutilizeforthemajorareasofworkfortheservices.1hebidderisfurthernotifiedthatallsubcontractorsshallbeproperlylicensed,bondable,andshallberequiredtofurnishtheCitywithaCertificateofInsuranceinaccordancewiththecontractgeneralconditions.Failuretofurnishthisinformationshallbegroundsforrejectionofthebidder’sproposal.(Ifnosubcontractorsareproposed,state“None”onfirstlinebelow.)SubcontractorName&AddressScopeofWorkLicenseNumberSFMwillutilizeitsownforcestocarryoutthescopeofworkforthiscontract.AuthorizedSignature:PrintorTypeName:Firm:SFMJanitorialServices.LLCDate:01202025Title:Manager50of92flllSFMWIIJanitorial 4.FIRMQUALIFICATIONS&EXPERIENCESFMJanitorialServices,LLC.,isSouthFlorida'strustedleaderinjanitorialservices,withadistinguishedlegacyspanningover50years.Knownforourreliability,expertise,andcommitmenttoexcellence,wehavebuiltastrongreputationfordeliveringexceptionalcleaningsolutionsthatconsistentlyexceedclientexpectations.SFMcleansover8millionsquarefeetthroughoutSouthFlorida!Since1972,SFMhasbeenthenamebehindthepristineappearanceofsomeofSouthFlorida'smosticoniclocations,includingthehistoricOrangeBowlStadium.Forover40years,SFMmaintainedthestadium'smanicuredlawnsandspotlessinteriors,ensuringitwasalwaysreadyforMiami'smostunforgettableevents.WhiletheOrangeBowlclosedin2007,SFM'smissionendures—enhancingSouthFlorida'smostnotablepropertieswithunmatchedcareandattentiontodetail.MiamiOrangeBowlStadiumYearsServiced:1972to2007Today,SFMisoneofthelargestandmostrespectedjanitorialserviceprovidersinSouthFlorida.Weproudlyserveover20municipalitiesandnumeroushigh-profilecommercialpropertiesacrossMonroe,Miami-Dade,Broward,andPalmBeachcounties.OurdistinguishedclientportfolioincludespremiervenuessuchastheUltraMusicFestivalandtheMiami-DadeCountyYouthFair,aswellaseducationalinstitutions,medicalfacilities,and24/7operations.Someofourmostnotableclientsinclude:•CityofCoralGablessince1991•CityofMiamiBeachsince2009•LeonMedicalCenterssince1998•CityofMiamiSpringssince2002•TownofMiamiLakessince2003•BaptistHealthsince2008WhatsetsSFMapartisourunparalleledinfrastructureandresources.Withafacilityspanning15,000squarefeetofofficespace,16,000squarefeetofwarehousespace,andover3acresofland,weareequippedtohandleprojectsofanysizeorcomplexity.Ourfleetof100+vehiclesandaccesstocutting-edgecleaningequipmentensureseamlessservicedeliveryeverytime.Asanindustryleader,SFMcombinestheexperience,managementexpertise,andoperationalscaleofanationalfirmwiththepersonalizedserviceandregionalknowledgeofadedicatedlocalcompany.Unlikeimpersonal,nationalcompetitors,weprideourselvesonaccessibilityandresponsiveness.OurclientsbenefitfromdirectaccesstoSFM'sExecutiveManagementTeam,ensuringimmediateattentiontotheirneedsatanytimeofday.(IISFM^11Janitorial WHYCHOOSESFMMADE-INDADEMiami-DadeCountyExperience:SFMistrulyaMiami-DadeCounty"Local"business.LocallyheadquarteredinSouthFloridasince1972,ourteamisrootedandhasindepthknowledgeoftheSouthFloridaarea.OurlocalpresencegivesSFManadvantageoverotherfirms.DirectOwnershipSupport:Unlikelarge-nationalimpersonalfirms,SFMisalocal,minority,family-ownedcompanyrunbyitsFoundingOfficers,JoseandChristianInfante.TheCityofSouthMiamiwillhavedirectaccesstoSFM'sproprietors24/7/365.RiskManagement:SFMhasarobustRiskManagement&SafetyProgramthatcontributestothebusinesscontinuityandsuccessofouroperations.SFM'sRiskManagementTeamiscomposedofthoroughqualitycontrol,training,andemployeeengagement.ThiscompositionallowsSFMtoquicklyidentify,assess,andmediateknownrisksaswellasidentifyingandsecuringpotentialunknownevents.Training:OurTeampridesitselfinhavingoneofthebestcombinedtrainingprogramsinSouthFlorida.Thequalityofservicewedeliverthroughextensivetraininghaspermittedustogrowexponentiallyoverthelastdecade.SFMstaffreceivecontinuoustraininginallareasofjanitorialprotocolstoensureourclientsgetthemostoutoftheirSFMexperience.BecauseSFMhasitsownin-housetrainingprogram,ourteamisnotlimitedtomonthlyorquarterlytrainings.Recruitment:Webelievethatthebestwaytoofferexceptionalservicetoourclientsistorecruitthemosttalented,dedicatedpeopleintheindustry.SFM'sexperiencedrecruitmentteamtargetslocalresidentsforemploymentopportunitiesthusfosteringcommunityinvolvementanddevelopment.SFMiswellknownforitslocalemploymentopportunities.CurrentlySFMServiceshasnearly1,000activeemployeesinMiami-DadeandBrowardCounty.Technology:SFMhasadoptednewtechnologythatofferstransparencyandreal-timeinformation.Ourweb¬basedmanagementsoftwareandscanningsystemscannowimmediatelydispatchservicesasneededinsteadofroutineschedules.ThisallowsSFMstafftoanticipate,preventandrespondmoreeffectively.IndustryKnowledge:Ourteamiscomposedofhighlymotivated,trained,andexperiencedpersonnel.TheSFMstaffhasthefollowingcredentials:ISSACertified,BSCAIMembers,APWAMembers,CertifiedFloorTechnicians,CertifiedCarpetCareTechnicians,SpartanGreenCleaningCertifications,andMOTCertified.Pa§^<361<ff8126<||SFM MEMBERSHIPSSFMisamemberoftheBuildingServiceContractorsAssociationInternational(BSCAI).Thisesteemedassociationisdedicatedtoadvancingtheinterestsofbuildingservicecontractorsandpromotingexcellencewithintheindustry.BybeingamemberofBSCAI,SFMgainsaccesstovaluableresources,networkingopportunities,andindustryinsightsthathelpusstayattheforefrontofbestpracticesandinnovation./WM01SFMisamemberoftheAmericanPublicWorksAssociation(APWA).Thismembershipgivesusaccesstothebesteducationandtrainingprogramsinpublicworks,aswellasnetworkingopportunitieswithmorethan31,500publicworksprofessionalsBOMAMIAMI-DADESFMisamemberoftheBuildingOwnersandManagersAssociation(BOMA)ofMiami-Dade.BOMAprovidesSFMwithavastsourceofinformationonbuildingmanagementandoperations,development,leasing,buildingoperatingcosts,energyconsumptionpatterns,localandnationalbuildingcodes,legislation,occupancystatistics,technologicaldevelopments,andotherindustrytrends.HealthCareEnvironmentSFMisamemberofTheAssociationfortheHealthCareEnvironment(AHE).AsamemberofAHE,SFMisalwaysattheforefrontofstate,federalandnationalregulations,industrytrends,bestpractices,andinnovationsinhealthcarefacilitymanagement.SFMrecognizestheimportanceofmaintaininghighstandardsinhealthcarefacilitymanagement,andbeingamemberofAHEreinforcesitsdedicationtoexcellence.BybeingapartofAHE,SFMgainsaccesstovaluableresources,educationalopportunities,andnetworkingevents.ThesebenefitsenableSFMtoenhanceitsknowledge,skills,andexpertiseinprovidingsafeandefficientenvironmentsforhealthcaredelivery.<||SFMIIJanitorialPaO%<3b1<fPl26 CAPACITYTOPERFORMSFMisfullycommittedtodedicatingthenecessarypersonnel,inventory,certifications,andotherresourcestoeffectivelyperformtheservicesrequiredunderthissolicitation.Inthissection,wewillprovidedetailedinformationdemonstratingourabilitytomeetandexceedyourexpectations.Personnel:AtSFMJanitorialServices,weunderstandtheimportanceofhavingaskilledandreliableteamtocarryouttherequiredservices.Wehaveastrongworkforceofhighlytrainedandexperiencedpersonnelwhoarededicatedtodeliveringexceptionalresults.Ourteamiscomprisedofjanitors,supervisors,andmanagerswhoarewell-versedinthelatestcleaningtechniquesandindustrystandards.Weensurethatourpersonnelreceivecontinuoustraininganddevelopmentopportunitiestostayupdatedwiththeever¬evolvingbestpracticesintheindustry.Inventory:Toensurethatwehavethenecessaryresourcestoperformtheservicesefficiently,SFMmaintainsacomprehensiveinventoryofcleaningsupplies,tools,andequipment.Weregularlyassessourinventorytoensurethatitiswell-stockedandup-to-date.Byusinghigh-qualitycleaningproductsandstate-of-the-artequipment,wecanprovideathoroughandeffectivecleaningservice.Certifications:SFMrecognizestheimportanceofcertificationsindemonstratingourexpertiseandcommitmenttoquality.Weholdvariouscertificationsrelevanttothejanitorialservicesindustry.OtherResources:Inadditiontopersonnel,inventory,andcertifications,SFMpossessesvariousotherresourcesthatenableustomeettherequirementsoftheRFP.Theseresourcesinclude:-RobustQualityAssuranceProgram:Wehaveimplementedacomprehensivequalityassuranceprogramthatinvolvesregularinspections,customerfeedbacksurveys,andperformanceevaluations.Thisprogramallowsustomonitorandcontinuouslyimproveourservicedelivery.-24/7CustomerSupport:Weunderstandthatcommunicationandresponsivenessarecrucialinprovidingexcellentservice.Ourdedicatedcustomersupportteamisavailablearoundtheclocktoaddressanyconcernsorinquiriespromptly.-TechnologicalAdvancements:SFMleveragesthepoweroftechnologytoenhanceouroperations.Weutilizeadvancedsoftwareforscheduling,tracking,andreporting,ensuringefficientmanagementandtransparency.(IlSFMIIJonitonal FINANCIALSTABILITYSFMJanitorialServices,LLC.,hasthefinancialsupportandworkingcapitalneededtofuelourresourcesandassetsessentialtoouroperations.SFMhasenoughbondingcapacitytoprovideperformanceandpaymentbondsinanamountnotlessthanonehundredpercent(100%)ofthecontractamountfromasuretyfirmratedA-(Excellent)byAMBest.SFMServiceshasneverdefaultedonacontractorfailedtoperformthroughitsentirety.SFMhasnotfiledforbankruptcy,iscurrentlyinbankruptcy,orhasbankruptcyactionpending.FinancialStatementsareavailableuponrequest.June17,2022SFMServices,Inc.9700NW79Ave.MiamiLakes,Fl33016Ref:BankReferenceLetter&CityNationalBankIkirnANCiAiG<inupToWhomItMayConcern:ThisletteristoconfirmthebankingrelationshipCityNationalBankofFloridahaswithSFMServices,Inc(SFM)since2012.SFMhashandledtheirdepositoryaccountsinasatisfactorymannerandlineofcreditasagreed,whilemaintainingaveragedepositorybalancesinthemedium7figures,withhighcreditinthemedium7figuresincludinglinesofcreditwithavailabilityinthe7mediumfigures.WelookforwardtocontinuingworkingwithSFMandassistingtheirgrowththroughoutthecomingyears.Pleasedonothesitatetocontactuswithanyquestionsat30S5777475.Thisletterisprovidedonbehalfofourclientwithoutliabilitytothebankand/oritsstaffVerytrulyyours,CityNationalBankofFlorida2855LeJeuneRoadCoralGables,FL33134Roberto.Blandomr'citynationaLco<||SFM”11JanitorialPa§^<3fe1<§|8126 LITIGATIONSFMJanitorialServices,LLC.,anditsrelatedentitiesmaybeincludedfromtimetotimeinlitigationbroughtagainstitsclientsduetothenatureofitsbusiness;thereisnopriororpendinglitigationthatwouldhaveamaterialadverseeffectonSFM'sabilitytodeliverservicesunderanyawardoftheRFP.ThereisnopendingorpriorlitigationinwhichtheTeamhasbeenaversetoanyofitsclientsorgovernmentalentities.<||SFMIIJanitorialPa§^«3fc\f|8126 LICENSES,CERTIFICATIONS,&INSURANCECertificateofStatusStateofFloridaDepartmentofStateIcertifyfromtherecordsofthisofficethatSFMJANITORIALSERVICES.LLCisalimitedliabilitycompanyorganizedunderthelawsoftheStateofFlorida,filedonMay9,2006.ThedocumentnumberofthislimitedliabilitycompanyisL06000047722.IfurthercertifythatsaidlimitedliabilitycompanyhaspaidallfeesduethisofficethroughDecember31,2020.thatitsmostrecentannualreportwasfiledonApril28.2020.andthatitsstatusisactive.GivenundermyhandandtheGreatSealoftheStateofFloridaatTallahassee,theCapital,thistheNineteenthdavofAugust,2020SecretaryofStateTrackingNumber:3698809230CUToauthenticatethiscertificate,visitthefollowingsite,enterthisnumber,andthenfollowtheinstructionsdisplayed.https^/services.sunbiz.orft'Tilings/CertificateOf&tatus-'CertificateAuthenticationl(IISFMWilJanitortaiPa§£^1<ff8126 CurrentAnnualFilingEntityName:SFMJANITORIALSERVICES.LLCCertificateofStatusDesired:NoDateElectronicSignatureofRegisteredAgentAuthorizedPerson(s)Detail:TitleMGRTitleMGRMNameINFANTE.CHRISTIANHNameSFMSERVICESINCAddress7500NW74THAVENUEAddress7500NW74THAVENUECity-State-Zip.MEDLEYFL33166City-State-Zip:MEDLEYFL3316603/20/2024SIGNATURE:CHRISTIANINFANTEMANAGERElectronicSignatureofSigningAuthorizedPerson(s)DetailDate(IISFM^11JanitorialTRIAY,CARLOS2301NW87AVE501DORAL,FL33172USCurrentPrincipalPlaceofBusiness:7500NW74THAVEMEDLEY,FL33166FEINumber:20-4908937NameandAddressofCurrentRegisteredAgent:2024FLORIDALIMITEDLIABILITYCOMPANYANNUALREPORTDOCUMENT#L06000047722IherebycertifytbcinioroeAanixlrjlctfanmpor!arsi^tta^Taj'rcpcrljsour?ent?eccu’atcantimatmyatetreme.t^’uiAurc-s*v*Yhaveirte.samelegalcfttcias<1mart?undercam.marfamamanagingmaaWe'crcfmeUnitedAactttyccmwnyormercccorra-trusteecmcciycrca!□cnxutettusreportascyCharier605.HerniaSrammo.utImarmynameappearsabalit.cyananaiiarfxTPiTfw.mat’otterAtocvryKJiwccLCurrentMailingAddress:7500NW74THAVEMEDLEY.FL33166USFILEDMar20,2024SecretaryofState6061389128CCTTestovenamedentitysvtohTsf/nssrartopurposeotchanging/isfegtsieredofficeatcegfsferedagemoctof/t.mrtoStareatFtorfda.SIGNATURE:Pa§%<3fe1<f0126 OccupationalLicenses001024LocalBusinessTaxReceiptMiami-DadeCounty,StateofFlorida-THISISNOTABILL-DONOTPAY5770830LBTjBUSINESSNAME/10CATI0NSFMJANITORIALSERVICESLLC7500NW74THAVEMEDLEYFL33166RECEIPTNORENEWAL3101375EXPIRESSEPTEMBER30,2025MustbedisplayedatplaceofbusinessPursuanttoCountyCodeChapter8A-Art.9&10OWNERSFMJANITORIALSERVICESLLCC/0CHRISTIANHINFANTEMCREmployee(s)30SEC.TYPEOFBUSINESS213SERVICEBUSINESSEXEMPTPAYMENTRECEIVEDBYTAXCOLIECTORSI35.0008/30/2024FPPU17-24-005079ThislocalBusinessTaxReceiptonlyconfirmspaymentoftheLocalBusinessTaxTheReceiptisnotalicense,permitoracertificationoftheholdersqualifications,todobusinessHoldermustcomplywithanygovernmentalornongovernmentalregulatorylawsandrequirementswhichapplytothebusiness.TheRECEIPTNO.abovemustbedisplayedonallcommercialvehiclesMiamiOodeCodeSec8a276.Formoreinformation,visitwww.mianiidade.gov/laxcolleclorTownofMedleyLOCALBUSINESSTAXRECEIPTBTAX25-2639VALIDOCT1,2024-SEPT30,2025SFMJANITORIALSERVICESLLC7500NW74AVEMedley,FL33166SFMJANITORIALSERVICESLLC7500NW74AVEMedley,FL33166IsherebyissuedaLocalBusinessTaxReceiptfortheTownofMedley,validthroughSeptember30thofthetaxyearlistedabovefortheoccupationof:JANITORIALSERVICES"IssuanceofthisBusinessTaxReceipt(BTR)isnotadevelopmentorzoningapproval.AllactivitiesandusesoperatedpursuanttothisBTRshallcomplywiththeTownofMedleyMunicipalCode,Miami-DadeCountyRegulationsandStateLaws.”FolioNo.22-3011-002-0740fllSFM11Janitorial MinorityBusinessEnterpriseSFMJanitorialServices,LLC.isthesubsidiaryofand100%ownedbySFMServices,Inc.,acertifiedminorityownedbusiness.JoseM.InfanteandChristianInfantestockholdersofSFMServices,Inc.areHispanic.SFMstronglyencouragestherecruitment,selection,andpromotionofminoritiesandwomeninthefirm.SeveralofSFM'svendorsareminorityownedaswell.AtSFM,weunderstandtheimportanceofpromotingdiversityandinclusivepracticesinourbusiness.WearecommittedtomakinggoodfaitheffortstoutilizeMinorityBusinessEnterprise(MBE)companieswhenanysubcontractingopportunitiesarise.Thiscommitmentalignswithourdedicationtofosteringequitableopportunitiesforallcontractorsandsuppliers,regardlessoftheirbackgroundoridentity.AnyquestionregardingMBEcertification,pleasecontactBeatriceLouissaint,PresidentoftheFloridaStateMinoritySupplierDevelopmentCouncil.(305.762.6151)THISCERTIFIESTHATSFMServices,Inc.NMSDCNationalMinoritySup,DevelopmentCouncil•Nationallycertifiedbythe:FLORIDASTATEMINORITYSUPPLIERDEVELOPMENTCOUNCIL‘NAICSCode(s):521732,5S172Q•Descriptionoltheirpruduct/swvicesasdefinedbytheNorthAmericanIndustryClassificationSystem(NAICS)12/01/2024IssuedDate12/01/2025ExpirationDateYingMcGuireNMSDCCEOandPresidentFL02106CertificateNumberBeatriceLoulssalnt,President&CEOByusingyourpassword(NMSDCissuedonly),authonzedusersmaylogintoNMSDCCentraltoviewtheentireprofile:httpivnmsdc.orgCertify.Develop.Connect.Advocate.*MBEscertifiedbyanAffiliateoftheNationalMinoritySupplierDevelopmentCouncil,Inc.®1IISFMWilJanitorialPag^<4t)1<f|8l26 ProudlyServicedSince19911ClientNameCityofCoralGablesContractNameRFPNo.2021-005-JanitorialMaintenanceServicesIContractTerm2016topresent&1991to2006ContractSizeApprox.250,000sq.ft.janitorialservicestoallCityownedfacilitiesincludingnightlycleaningofoffices,restrooms,commonareas.Dailyporterservicestorestroomsandcommonareas,carpetcleaning,stripping1ScopeofWork&refinishingfloors,highpressurecleaning,electrostaticdisinfectionservices,andotherspecialcleaningservices.SFMcleansapproximately12sitesinthiscontract.SFMalsoperformsSpecialEventCleaning.RalphRodriguezP:305.460.5014E:RRodriguezl@coralgables.comClientContact2800SW72ndAvenueMiamiyf^rf4g33155 MIAMIBEACHCITYClientNameCityofMiamiBeachRFP2017-070-JCJanitorialServicesContractName2019topresentContractTermApprox.2.4millionsq.ft.ContractSizeScopeofWorkElizabethMiroP:305.673.7000x.22925E:ElizabethMiro@miamibeachfl.govClientContactJanitorialservicesareperformedthroughouttheCityatallcityownedfacilities,parkinggarages,publicrestrooms,andparkrestrooms.SFMcleansapproximately63sitesinthiscontract.SFMalsoperformsSpecialEventCleaning.1833BayRd.,2ndFloor,MiamiBeach,FL3313972of158ProudlyServicedSince2019 ProudlyServicedSince2020IClientNameMiami-DadeCountyAviationDepartment11ContractnameFB-01167JanitorialServicesforMIA&GeneralAviationAirportsZone41ContractTerm2020topresent।ContractSizeApprox.1.5millionsq.ft.JanitorialServicesfortheMiami-DadeAviationDepartment.Servicesareexclusivetoallnon¬ScopeofWorkterminalbuildings,airportproperties,andotheroutlyingbuildingsatMiamiInternationalandGeneralAviationAirportsdefinedasZone4.SFMcleansapproximately27sitesinthiscontract.UltimoDeOliveiraP:305.876.8447E:UDeOliveira@miami-airporf.com11ContactFacilitiesManagement&EngineeringDivisionP.O.Box025504Miami,FL33102-550473of158 ProudlyServicedSince2008BaptistHealthSouthFloridaRFP215JanitorialServices2008topresentApprox.1.1millionsq.ft.janitorialservicesatvariouslocationsthroughoutitssystem.Servicesincludedaytimeandnighttimporterservices,floorcare,andconsumables.Additionalservicesrequestedmayincludehigdusting,pressurecleaning,andgaragecleaning.SFMcleansapproximately23sitesinthcontract.YaneiPerezP:305.812.9179E:yaneip@baptisthealth.net1228SouthPineIslandRoadPlantation,FL3332474of158ClientNameContractnameContractTermContractSizeScopeofWorkContact ProudlyServicedFrom2017to2023ClientNameContractnameContractTermContractSizeScopeofWorkContactBrowardHealthOffsiteJanitorialServices2017to2023Approx.200,000sq.ft.janitorialservicesatvariouslocationsthroughoutitssystem.Servicesincludedaytimeandnighttimeporterservices,floorcare,andconsumables.Additionalservicesrequestedmayincludehighdusting,pressurecleaning,andgaragecleaning.SFMcleanedapproximately14sitesinthiscontract.DougFennemaP:954.355.5976E:dfennema@browardhealth.org1608SE3rdAveFortLauderdale,FL3331675of158 JB(OIjBClientNameMiami-DadeCountyYouthFairandExpositionCleaningServicesContractname1978topresentContractTermContractSizeScopeofWorkContactApprox.200,000sq.ft.ofbuilding+80AcresofFairgroundsSFMprovidescleaningservicesbefore,during,andaftertooneoftheNation'slargestannualfairs.TheMiami-DadeCountyYouthFairandExpositionbringsinoverhalfamillionattendeesyearly.Thefairgroundiscomposedof80AcresofFairgroundsand5exhibitionbuildingsthatapproximate200,000sq.ft.RosaMMadrugaP:305.223.7060E:rmadruga@fairexpo.com10901CoralWayMiami,FL3316576of158 ClientNameContractnameContractTermContractSizeScopeofWorkContactLeonMedicalCentersJanitorialServices1998topresentApprox.394,000sq.ft.Custodialservicesto14medicalfacilitiesinMiami-DadeCounty.MichaelShealyP:305.631.5933E:Michael.Shealy@LeonMedicalCenters.com8600NW41stStreet,Miami,FL3316677of158IProudlyServicedSinceI998 PUBLICENTITYEXPERIENCEProudlyServicedSince1991ClientNameCityofCoralGablesContractnameRFPNo.2021-005-JanitorialMaintenanceServicesContractTerm2016topresent&1991to2006ContractSizeApprox.250,000sq.ft.ScopeofWorkjanitorialservicestoallCityownedfacilitiesincludingnightlycleaningofoffices,restrooms,commonareas.Dailyporterservicestorestroomsandcommonareas,carpetcleaning,stripping&refinishingfloors,highpressurecleaning,electrostaticdisinfectionservices,andotherspecialcleaningservices.SFMcleansapproximately12sitesinthiscontract.SFMalsoperformsSpecialEventCleaning.ContactRalphRodriguezP:305.460.5014E:RRodriguezl@coralgables.com2800SW72ndAvenueMiami,Florida33155ProudlyServicedSince2019ClientNameCityofMiamiBeachContractnameRFP2017-070-JCJanitorialServicesContractTerm2019topresentContractSizeApprox.2.4millionsq.ft.ScopeofWorkJanitorialservicesareperformedthroughouttheCityatallcityownedfacilities,parkinggarages,publicrestrooms,andparkrestrooms.SFMcleansapproximately63sitesinthiscontract.SFMalsoperformsSpecialEventCleaning.ContactElizabethMiroP:305.673.7000x.22925E:ElizabethMiro@miamibeachfl.gov1833BayRd.,2ndFloor,MiamiBeach,FL33139ProudlyServicedSince2020ClientNameMiami-DadeCountyAviationDepartmentContractnameFB-01167JanitorialServicesforMIA&GeneralAviationAirportsZone4ContractTerm2020topresentContractSizeApprox.1.5millionsq.ft.ScopeofWorkJanitorialServicesfortheMiami-DadeAviationDepartment.Servicesareexclusivetoallnon-terminalbuildings,airportproperties,andotheroutlyingbuildingsatMiamiInternationalandGeneralAviationAirportsdefinedasZone4.SFMcleansapproximately27sitesinthiscontract.ContactMichaelSimmP:305.876.8479E:MSimm@flymia.comP.O.Box025504Miami,FL33102-5504(IISFMWIMonitorialPag%<4fe1<f|8l26 ProudlyServicedSince2023pmpano^beachFlorida'sWarmestWelcomeClientNameCityofPompanoBeachContractnameE-24-23JanitorialServicesContractTerm2023topresentContractSizeApprox.74,387sq.ft.ScopeofWorkDailyjanitorialservicesareperformedatCityHallandvariousofficeswithinCityHallknownasGroup1.ContactGeorgeBuenaventuraP:954.786.4108E:George.Buenaventura@copbfl.com100WestAtlanticBlvd.PompanoBeach,FL33060ProudlyServicedSince2019ClientNameTownofCutlerBayContractname23-01ProfessionalJanitorialMaintenanceServicesContractTerm2023topresentContractSizeApprox.24,500sq.ft.ScopeofWorkDailyjanitorialservicesareperformedatvariousTownHallOffices.ContactJazminGonzalezP:786.573.5504E:JGonzalez@cutlerbayfl.gov10720CaribbeanBlvd.,Suite210CutlerBay,Florida33189ProudlyServicedSince2019ClientNameVillageofPalmettoBay•».«’,Contractname2022-11-008JanitorialServicesContractTerm2022topresentContractSizeApprox.26,000sq.ft.ScopeofWorkDailyjanitorialservicesareperformedattheVillageHallandPublicServiceOffice.ContactKarlaMoralesP:786.354.5546E:kmorales@palmettobay-fl.gov9705EastHibiscusStreetPalmettoBay,FL33157Additionalreferencesareavailableuponrequest.<||SFMwIIJanitorial REFERENCELETTERSFrom:Rodriguez,Ralph<rrodriguezl@coralgables.com>Sent:Monday,Novembers,20231:24PMTo:PascaleLopez<plopez@sfmservices.com>;ChristianInfante<Clnfante(g>sfmservices.com>Subject:Letterofrecommendationandappreciation.DearChristian:Ijustwanttothankyouandinformyou,ofhowpleasedwearewiththejanitorialservicesSFMhasbeenproviding.Yourstaffisalwayswelltrainedandcourteous,andapleasuretoworkwith.SFMisresponsibleforover230,00squarefeetoffacilities,plushandlesallourspecialevents.AtestamenttotheserviceSFMprovidesistheworkingrelationshipyou'vehadwiththecityforover20years.Againthankyou.RalphRodriguez;NCIDQ.ENVspChief,GeneralServicesAdministrationDivisionCityofCoralGablesPublicWorksDepartment2800SW72ndAvenue/Miami,Florida33155(305)460-5014/rrodriguezl©coralgables.com"simplicityisaboutsubtractingtheobvious,andaddingthemeaningful"Pa§^«61<f|8126(IlSFM11Jonitorlol TheCityofCoralGablesPiiMcWi'rfoDtW/jiiiMlSW72AvEnUCMIAMI.fturni^l55Thursday,March15"',2018Christianinfante5FMServices,Inc.9700NW79thAve.HialeahGardens,FL.33016DearChristian:Ijustwanttowriteyouaquicknotetoirfonnyouhowpleasedwearewiththejanitorialservices5FMhasbeenproviding.Yourstaffiswelltrainedandapleasuretoworkwithonadailybasisastheycleanapproximately230,000squarefeetoffacilities.AtestamenttotheserviceSFMprovidesistheworkingrelationshipyou’vehadwiththeCityforover20years.Keepupthegoodwork!RalphRodriguezPublicWorksPa|i«f|1<f|8l26(IISFMWilJanitorial MIAMIBEACHCityofMiamiBeach.1700ConventionCenfeiDrive.MiamiBeach.Florida33139.www.miamibeacnf.govPROPERTYMANAGEMENTDEPARTMENTDecember17,2019ToWhomifMoyConcern:PleaseallowtnislettertoconfirmSFMServices.Inc.isthejanitorialserviceproviderfortheCityofMiamiBeach.TheirjanitorialcontracthasacompexscopeofworkandschedulesandmanyofthefacilitiesO'eserviced24/7.JanitorialservicesareperformedthroughouttheCityatallcity-ownedfacilities,parknggarages,publicrestrooms,andparkrestrooms.Itismyunderstandingtheycurrentlyemployapproximately65employeestoperformtniswork.Thetota1squarefootagecleanedbySFMonadailybasisisapproximately2/54,335squarefeet.<||SFMIIJanitorialPa§%«6150126 BAPTISTMFATHBHERealEstate&DevelopmentCorp.8500S.W.117AvenueSuite101Miami,FL33183March23.2018ChristianInfanteSFMServices,Inc.9700NW79lhAvc.HialeahGardens,FL.33016DearChristian:Thisletteristodocumenthowpleasedwearewiththejanitorialservicesyourfirm,$FM,hasbeenprovidingforusattheBaptistMedicalArisBuildingsforthepastseveralyears.Yourteamcertainlyhastheirworkcutoutforthemwithmorethan240,000squarefeetofmedicalofficespacebetweenthetwobuildings,whichalsoincludes"TerminalCleaning'1sorvresprovidedforouroperatingroomsinthesurgerycenter.Thehighlevelofqualityservicethatisexpectedandrequiredatourmedicalfacilitiescanonlybedeliveredbyahighlyexperiencedcontractorsuchasyourself.Havingyourteamtrainedtoworkinaspecializedmedicalfacilitysuchasoursisgreatlyappreciatedandhasnotgoneunnoticed.Thankyouandyourteamforallthehardwork.Pleasefeelfreetolistmeareference.•krica£-lini&y-JtgostiniPK&wtyMjarjigctfUBaptistHealthEnterprisesRea)Estate&Developmenturmitaurn’.nej8950NKotuJaMOfwSole100WMiamiFl33*76Tel766.596.7498Fox3052706O3SEntailnnlToon»vstaeefbuMtcV*icy.pto.-Klrq-K-.-ii”<||SFMWliJanitorialPa§3;<B&1<$8l26 Monday,March192O1HChristianInfaiHeSFMServices,Inc.9700NW7&!l'i\w.HialeahGardens.FL.J331CDearClifstumThisletteristoconfrmSTMServices.Inc.hasbeenprovdingjanitorialservicestoailourmedicalcenterssince1997Cuventlyyourfirmcleansseven(71medicalrente'stotalnj;over300.000squarefeetYourcooperation,andflexibilityhavealwaysbeenexcellent,andyourCrC-wSarewelltrainedInequalityservicerenderedbyyourstaffisinstrumentalinourungomfisuccessrtin'healthcareromrrnii’ity4eultreetnlistusnsareference-ISincerely,z"y'c'-taridyHi.11iv//VicePresdpi/<||SFMWIIJonitorio!Pa§^«5»'l<5l8126 6.KEYPERSONNELANDQUALIFICATIONSSFMExecutiveLeadershipJoseM.Infante,FounderofSFMServices.JoseM.Infante,FounderofSFMServices,possessesover50yearsofextensiveexperienceinthepublicserviceandcommercialjanitorialandlandscape.Throughouthiscareer,Mr.Infantehasdemonstratedexceptionalexpertiseinareassuchaslandscapedesign,maintenance,andenvironmentalstewardship.Hehasplayedapivotalroleinoverseeinglarge-scaleprojects,ensuringcompliancewithindustrystandards,anddeliveringhigh-qualityresultsforbothprivateandmunicipalclients.AsaformerchairoftheAmericanPublicWorksAssociation(APWA),Mr.Infantehasbeenattheforefrontofadvancingindustrypracticesandpromotingsustainablelandscapingsolutions.HisimpressiveportfolioofcertificationsincludesISACertifiedArborist,FNGLALandscapeMaintenanceTechnician,MOT,PesticideApplicator,andFertilizerApplicatorlicenses,whichunderscorehiscommitmenttoprofessionalexcellence.Inadditiontohistechnicalskills,Mr.Infanteexcelsinbusinessmanagementanddevelopment,leveraginghisknowledgetogrowSFMServicesintoatrustedleaderintheindustry.ChristianInfante,President.ChristianInfante,PresidentandCEOofSFMServices,Inc.,hasover26yearsofexperienceinthepublicserviceindustry,specializingincommercialjanitorialandlandscapeservicesforbothprivateandpublicsectors.Heholdsabachelor'sdegreeinbusinessmarketingandmanagementfromFloridaInternationalUniversityandisanISACertifiedArborist.InhisleadershiproleatSFMServices,Mr.Infantetakesahands-onapproachtoeveryaspectofthebusiness.Heisactivelyinvolvedincontractnegotiations,businessdevelopment,andensuringtheseamlessexecutionofservices,whilemaintainingarigorousfocusonqualityassurance.Hisstrategicvisionalsodrivesthefinancialhealthandoperationalgrowthofthecompany,makingSFMServicesatrustedleaderintheindustry.Additionally,Mr.InfanteservesastheleadProjectManagerforallemergencyanddisasterrecoveryoperations.Hisabilitytocoordinatelarge-scalerecoveryeffortsunderchallengingconditionshighlightshisexpertiseincrisismanagementandreinforcesSFMServices'reputationforreliabilityandexcellence.<||SFM11JanitorialPa§&®fe1<5P126 IsraelRosado,COO.IsraelRosado,ChiefOperatingOfficerofSFMServices,isahighlyexperiencedandaccomplishedexecutivewithaproventrackrecordofleadinglarge-scaleoperations.Hiscareerisdefinedbyhisanalyticalapproachtoproblem-solving,which,combinedwithhisextensiveexpertiseinprojectmanagement,hasconsistentlydrivenoperationalefficiencyandcreatedexceptionalcustomervalue.Mr.Rosadoholdsabachelor'sdegreeinfinancefromFloridaInternationalUniversity.Hisfinancialacumen,coupledwithhisabilitytostreamlineprocessesandmanagecomplexprojects,hasmadehiminstrumentalinoptimizingSFMServices'operationsandensuringthesuccessfulexecutionofinitiatives.AsCOO,heremainsfocusedonenhancingorganizationalperformanceanddeliveringsuperiorresultsforclientsacrossallsectors.TerryAlfonso,CorporateController.Ms.AlfonsojoinstheSFMteamwith30yearsofcorporateaccountingexperienceandawealthofknowledgeinTaxlaws.Sheearnedherbachelor'sandamaster'sdegreeinaccountingfromFloridaInternationalUniversityandiscurrentlyaprofessoratMiamiDadeCollegewheresheteachesAccountingandTax.Ms.Alfonsoisdirectlyresponsibleforallaccountingandfinancefunctionsinclusiveofrevenuecyclemanagement,costaccounting,treasury,andfinancialreportingatSFM.BarbaraFindo,DirectorofHumanResourcesandSafety.AsDirectorofHumanResources&Safety,Barbieservesasastrategicbusinesspartnerfocusedonplanning,leading,directing,developing,andcoordinatingthepolicies,activities,andstaffoftheHumanResource(HR)andSafetydepartments,whileensuringlegalcomplianceandimplementationoftheorganizationsmissionandtalentstrategy.AsDirectorofHumanResources&Safety,Barbieservesasastrategicbusinesspartnerfocusedonplanning,leading,directing,developing,andcoordinatingthepolicies,activities,andstaffoftheHumanResource(HR)andSafetydepartments,whileensuringlegalcomplianceandimplementationoftheorganizationsmissionandtalentstrategy.(||SFMWIIJanitorial VanezzaRivera,ExecutiveAdministrativeAssistant.Ms.RiveraservesasacorporateassistantatSFM.HerprimaryroleistoprovidesupporttoSeniorOfficersandensurethatallgovernmentcontractingopportunitiesareeffectivelymanaged.Shedevelopsformalbidqualifyingproposalsandsubmittalmaterialsforpurchasingcommittees.Additionally,sheisresponsibleforadministeringandmanagingcontracts,vendorregistrations,certificatesofinsurance,andliabilityclaims.Ms.Riveraisresponsibleforresearching,identifying,andcontactingpotentialresourcesfordisasterrecoveryservices.In2017postHurricaneIrma,Ms.Riveracoordinateduptothirty-fiveindividualsubcontractorsandhadover250debrishaulingtrucksincirculationdailythroughoutMiami-DadeCounty.Ms.Riveraisabonded&insuredNotaryPublicfortheStateofFloridaDainethDeAbreu,BenefitsandRetentionManagerMs.DeAbreuholdsdualrolesatSFM-servingastheBenefitsandRetentionManageraswellastheAccountingManager.Herdynamicpositionatthecompanyrequireshertobringfusionandbalancebetweenthesetwoareas,ensuringboththefinancialcomplianceandauditsareuptodatewhilealsoevaluatingandimplementingstrategiesformanagingthebenefitsandretentionofalmost1,000employees.Inherrole,Ms.DeAbreuplaysacrucialroleinensuringthatSFMremainscompetitiveinthelabormarket.Byeffectivelymanagingbenefitsandretention,shehelpsourcompanyattractandretaintoptalent,ensuringthatwehaveastronganddiverseworkforce.SophieCasas,TalentAcquisitionManager.Ms.CasasholdsthepositionofLeadRecruiterwithinourorganization.WithabackgroundinPsychology,Sophiaoverseesacomprehensivetalentselectionprocessacrossourcompany.Herguidingprincipleisrootedinthebeliefthatwehirebasedoncharacterandsubsequentlyrefineskillsthroughtraining.AstheLeadRecruiter,Sophiaisresponsibleforoverseeingtheentiretalentacquisitionprocess.ThisincludesJobPostingandSourcing,CandidateScreening,CandidateEvaluation&Interviewing,joboffersandfacilitatesthehiringprocess.<||SFMIIJanitorial LuisSanchez,RiskandSafetyManager.Mr.SanchezisanaccomplishedEnvironmentalHealthandSafetyprofessionalwithadistinguishedrecordofleadingteams,optimizingprocesses,andenhancingsystemstodrivebottom¬lineperformances.Withadata-drivenapproach,Luisexcelsindesigningprogramsthatharmonizecorporateobjectiveswithregulatorymandates,equippingcompanieswiththenecessaryresourcestounlockpotentialandachieveoperationalexcellence.Luisbringsover20yearsofmilitaryexperiencetohisrole,complementinghispositionasaseniorbilingualinstructor.AlbertoSalones,FleetManager.Mr.Salonesplans,directs,andcoordinatestheoperationofSFM'sfleetofvehiclesandequipment.Someofhisdutiesincludepurchasing,costreductionstrategies,preventivemaintenancetoequipmentandvehicles,fuelmanagement,andGPStrackingmanagement.Mr.Salonesalsocoordinatesourfacility'smaintenanceandoverseesourthreein-housemechanics.MarthaGonzalez,QualityControlOfficer.Mrs.Gonzalezhas30yearsofexperienceinthejanitorialserviceindustry.PriortojoiningSFMshewastheManagerofHousekeepingoperationsatDolphinMall.MartaistrainedinallaspectsoftheOrangeQCweb-basedqualitycontrolsoftware.EileenDominguez,QualityControlOfficer.Mrs.Dominguezhasover30yearsofexperienceinthejanitorialindustry.Priortohercurrentpositionshewasadistributorfor3Mjanitorialsupplies.HerexperienceandknowledgeinjanitorialsuppliesandservicesmakeheranassettotheSFMTeam.EileenistrainedinallaspectsoftheOrangeQCweb-basedqualitycontrolsoftware.<||SFM11JanitorialPa|&«fe1<§|8l26 SFMJanitorialOperationsTeamPascaleLopez,GeneralManager-JanitorialDivision.Mrs.LopezoverseesalljanitorialoperationsforSFMincludingplanning,coordinating,andexecutingoperationalprojects.SheisanISSACITScertifiedmastercleaner.Shehasathoroughknowledgeofmodernpractices,techniques,andtoolsusedinjanitorialwork.Mrs.Lopezhasaremarkableabilitytodirect,supervise,andtrainsubordinatesandastrongabilitytodetect,analyze,andtakeappropriateactiontomediateandcorrectmaintenanceproblems.ShehashelpedhospitalsprepareforJCAHOandAHCAinspections.AlejandroDiCola,ProjectManager.AlejandroDiColajoinedtheSFMTeamin2018.Hebringsawealthofexperiencefromthemunicipalpublicworkssector.AlejandrostartedoffworkingasaheavyequipmentoperatorandrosethroughtheranksasaprojectmanageroverseeingallSFM'sfloorcare,pressurewashingandstreetsweepingoperations.Alejandroisaseasonedprofessionalinthefieldofspecialfloorcleaningservices.Heisfamiliarwiththeuniquecharacteristicsandcarerequirements,chemicals,andequipmentforallfloortypes.Alejandro'sknowledgeandexperienceenablehimtoprovidetailoredcleaningsolutionsspecifictoeachfloortype,ensuringitslongevityandmaintainingitsaestheticappeal.Hisexpertise,attentiontodetail,andcommitmenttocustomersatisfactionmakehimatrustedchoiceforclientsseekingexceptionalcleaningresults.Additionally,asaleaderhehascommunicationskillsthatenablehimtonotonlygetahigherlevelofperformanceoutofouremployeesonaday-to-daybasisbut,alsowhenchallengingsituationsarise.MyrnaDelgado,EventsManager.Ms.DelgadobringstheSFMteamanunparalleledabilitytorecruit,train,orientandmotivatestaff.Atrue"handson"bilingualmanagementprofessionalwithover25yearsjanitorialserviceoperationsexperience.Myrnahasorchestratedeventsstaffingandmanagingeventvenuesinexcessof100,000attendeesperday.Sheisoneofourvaluedkeypersonnelandhasgainedatremendousworkingknowledgeofeventstaffingoverthelast20years.(IISFM^11JanitorialPa§$<#1<50126 PedroReus,AccountManager.Mr.Reushasovertwentyyears'experienceingeneralmanagementandovertenyears'experiencemanagingastaffofover1,500.Hehasthoroughknowledgeofmodernpracticesandtechniques,tools,equipment,andmaterialsusedincustodialworkdirectlyrelatedtomunicipalbuildings.Hehasstrongknowledgeofoperationalcharacteristics,services,andactivitiesofmunicipalbuildingsandextensiveknowledgeoffederalrulesandregulationsaffectingdailyoperations,includingsafetyandsecurityregulationsandprocedures.Mr.Reushasexceptionalknowledgeofsafeandefficientworkpracticesandimmenseknowledgeoftheprinciplesofsupervision,training,andperformanceevaluation.OrlandoReyes,AccountManager.Mr.Reyespossessesextensiveexperienceandexpertiseinthefieldofgeneralmanagementandhassuccessfullyledlargeteamsforovertenyears.Withmorethantwentyyearsofexperience,hehashonedhisskillsinmanagingallaspectsofbusinessoperations,includingstrategicplanning,budgeting,andresourceallocation.Furthermore,Mr.Reyespossessesanexceptionalunderstandingoftheoperationalcharacteristics,services,andactivitiesofmunicipalbuildings.Thiscomprehensiveknowledgeenableshimtoeffectivelycoordinateandsupervisevariousaspectsofday-to-dayoperations,ensuringefficiency,cost-effectiveness,andcompliancewithrelevantrulesandregulations.Oneofhiskeyareasofexpertiseiscompliancewithfederalrulesandregulations,particularlythoserelatedtosafetyandsecurity.Mr.Reyesiswell-versedintherequirementsimposedbytheseregulations,andhisexpertiseenableshimtoimplementandenforcebestpracticestokeepmunicipalbuildingssecureandsafeforalloccupantsandvisitors.MaraHernandez,AccountManager.Ms.Hernandezhasover12yearsofexperienceinthejanitorialindustry.Shehasvastknowledgeintheretailandmedicalsector.Someofherdailydutiesincludeprojectoversite,monitoringstaff,andreportingtimeandattendance.Toaccomplishthis,Marareliesonourweb-basedqualitycontrolcheckpointsystem,Silvertrac.SheiscertifiedinTerminalcleaningandBloodbornepathogensandhasexceptionalknowledgeofsafeandefficientworkpractices.Pa§%«t)1<5l8126<||SFMWIIJanitorial RESUMESJoseM.InfanteFounderjinfante@sfmservices.comEducation1963to1967ChristopherColumbusHighschool1968to1971MiamiDadeCommunityCollegeAssociatesDegree1971to1972UniversityofMiamiExperience1972to1986PropertyManagement&MaintenanceVicePresident&StockholderInchargeofalljanitorialoperationsRecruitmentofpersonnel1987toPresentSFMServices,Inc.Founder&StockholderOverseeallaspectsofjanitorialandlandscapeoperations.Overseeallday-to-dayactivitiesforbothdivisionsOverseeallfinancialaspectsofcompany.BusinessDevelopmentAdditionalSkillsFluentinEnglishandSpanishComputerliterate:MicrosoftWord,Excel,PowerPointEffectiveCommunicationandLeadershipskillsISAFloridaCertifiedArboristVolunteerActivitiesDirectorofCubanDemocracyPACMemberofAmericanPublicWorksAssociationPaBt«f|1<5l8126<||SFM”11Janitorial ChristianInfantePresidentcinfante@sfmservices.comEducation1992to1996ChristopherColumbusHighschool1997to2002FloridaInternationalUniversityBachelor'sdegreeinbusinessadministration2006UniversityofFloridaCertificateCourseinHorticulture2008ISACertifiedArboristExperience1998toPresentSFMServices,Inc.Overseeallaspectsofjanitorialandlandscapeoperations.Implementedfloorcareprograms.NewaccountstartupsDirectlyinvolvedinallphasesofdisasterrecoveryprojectsMaintainbusinessrelationswithclientsPreparegovernmentbidsSalesandMarketingNewcontractnegotiationsandbusinessdevelopmentAdditionalSkillsCertifiedArboristwithISATerminalcleaningcertifiedBloodbornepathogencertifiedFluentinEnglishandSpanishComputerliterate:MicrosoftWord,Excel,PowerPointEffectiveManagementCommunication,andLeadershipskills,C.P.R.CertifiedVolunteerActivitiesMiamiLighthousefortheBlindBusinessAdvisoryBoardBoardofdirectorsofJosePeresALSRecoveryGolfClassicTrusteeMember,GreaterMiamiChamberofCommercePag£S&1<§0126fllSFM^111Janitorial IsraelRosadoCOOirosado@sfmservices.comEducationFloridaInternationalUniversityBachelor'sDegreeinBusinessAdministration-FinanceHarvardBusinessSchoolLaunchingBreakthroughTechnologiesFloridaInternationalUniversityExecutiveStrategyManagementExperience2019to2023NovusHealthInsurance(FormerlyPAGroup)ChiefOperatingOfficer|ManagingDirectorLedanoperationaltransformationandportfoliospinoff.2012-2019BestDoctorsInsuranceVicePresidentofStrategyandAnalyticsLedascalablebuildoutofaglobaloperationviamultiplesites.2009-2012BUPADirectorofProgramandChangeManagementLedmergerandoperationalintegrationofacquisitions.2007-2009TransconLabourGroupVicePresidentofSalesandMarketing1995-2006DeltaAirlinesVariousManagerialPositionsAdditionalSkillsStrategicPlanningandImplementationGlobalBusinessOperationsManagementBusinessProcessReengineeringProgram&ProjectManagementResourceAllocation/OptimizationComputerliterate:MicrosoftWord,Excel,PowerPointExecutiveManagement<||SFM^11Janitorial PascaleLopezJanitorialManagerplopez@sfmservices.comEducation2014FloridaInternationalUniversityExecutiveManagementProgram2012MiamiDadeCollegeAssociateinbusinessadministrationExperienceSFMServices,Inc.-JanitorialManagerOverseesmorethan400employeesand15areamanagers.Planning,coordinating,andexecutingjanitorialprojects.Responsibleformeetingcleaningstandardsofallmedicalfacilities/sitesincludingBaptistlocations,LeonMedicalCenters,andBrowardHealthlocations.NorthShoreMedicalCenterAssistedwith"JointCommission"conductingsafetyrounds.PreparationwithJCAHOandAHCAinspections.Supervisedmaintenanceengineerstoachieveeffectivemaintenanceplan.GlobalBusinessManagement,HumanResourceManagerDevelopedpoliciesandproceduresaswellasrequiredtraining.AllaspectsofHR:Payrollprocessing,worker'scompclaims,drugfree,etc.AdditionalSkillsCertifiedindealingwithBloodbornePathogens.CertifiedinTerminalCleaning.SpartanGreenCleaningSolutions.<||SFMIIJanitorialPag*<^^126 7.APPROACHTOPERFORMTHESERVICESASREQUESTEDOVERALLAPPROACHTOACCOUNTMANAGEMENTSFM'soverallapproachtoaccountmanagementfortheCityofSouthMiamiencompassesacomprehensiveandsystematicstrategyaimedatensuringthehigheststandardsofcleanlinessandhygienethroughoutthecity.Withafocusondeliveringexceptionalservice,SFMemploysaproactiveapproachthatemphasizeseffectivecommunication,meticulousplanning,andcontinuousimprovement.OnekeyaspectofSFM'saccountmanagementapproachisestablishingclearlinesofcommunicationwithSouthMiami.Byfosteringopenandtransparentcommunicationchannels,SFMensuresthatanyconcernsorissuesregardingjanitorialservicesarepromptlyaddressedandresolved.Thiscollaborativeapproachallowsforeffectiveproblem-solvingandensuresthatthespecificneedsandrequirementsofSouthMiamiaremet.ContinuousimprovementisanotherfundamentalaspectofSFM'saccountmanagementapproach.SFMunderstandsthatthejanitorialindustryisconstantlyevolving,withnewtechnologies,products,andbestpracticesemergingregularly.Tostayaheadofthecurve,SFMactivelyseeksoutinnovationandembracesnewtechniquesandtoolsthatcanenhancethequalityandefficiencyofjanitorialservicesinSouthMiami.Byregularlyevaluatingandupdatingourpractices,SFMisabletoensurethatweareattheforefrontoftheindustry,deliveringthehighestlevelofservicetoSouthMiami.ResourceAllocation:Toensureproperresourceallocation,SFMJanitorialwillconductacomprehensiveassessmentofitsavailableresources,includingpersonnel,equipment,andsupplies.Theobjectiveistoavoidresourceoverallocationandmaintainoptimalefficiencyacrossallprojects.PersonnelDistribution:Inlightofthepotentialcontract,SFMwillevaluatetheexistingpersonnelcapacityandskillstodetermineifadditionalresourcesarerequired.Ifnecessary,SFMJanitorialwillrecruitandtrainnewstaffmemberstomeetthedemandsofthepotentialcontract.RoutingWorkandUnforeseenEvents:SFMJanitorialrecognizestheimportanceofbeingpreparedforunexpectedevents,suchastropicalstormsandhurricanes,thatmaydisruptregularworkroutines.Insuchsituations,SFMwillhaveadedicatedemergencyresponseteamreadytoaddressurgentcleaningneedsandensureminimaldisruptiontoongoingoperations.Thisteamwillbeequippedwiththenecessaryresources,includingspecializedequipmentandsupplies,toefficientlyhandlepost-stormcleaningandrestoration.<||SFM11JanitorialPa^«fe1<§f8l26 WEB-BASEDRESTROOMTECHNOLOGYSFMproposestoimplementJanitorialManager,aweb-basedsoftware,tostreamlineandtracktargetareaswithinthescopeofwork.ThispowerfultoolenablesSFMtomanageanddocumentvariousaspectsofthejanitorialprocess,ensuringefficientoperationsandadherencetoqualitystandards.TrackingandDocumentationJanitorialManagerprovidesSFMwithacomprehensivesystemfortrackingthecleanlinessandmaintenanceoftargetareas.ThesoftwareallowsSFMtocreateandassignspecifictaskstoteammembers,ensuringthateachareaismonitoredandcleanedregularly.Bydocumentingtheseefforts,SFMcanmaintainaccuraterecordsanddemonstratecompliancewithrelevantregulations.TargetedApproachOneofthekeyfeaturesofJanitorialManagerisitsabilitytosegmentandprioritizetargetareasbasedonspecificcriteria.SFMcandefinetargetareasbasedontheirimportance,frequency,orcomplexity.Byfocusingontheseareasfirst,SFMcanensurethatthemostcriticalareasreceivethemostattention,resultinginimprovedoverallcleanlinessandhygiene.TimeandResourceOptimizationJanitorialManagerequipsSFMwithpowerfultoolstooptimizetheuseoftimeandresources.ThesoftwareenablesSFMtoscheduleandassigntasksbasedontheavailabilityofteammembersandequipment.Byleveragingthisschedulingfunctionality,SFMcanoptimizetaskallocationandstreamlineoperations,resultinginmoreefficientuseofavailableresources.CommunicationandCollaborationJanitorialManagerfacilitateseffectivecommunicationandcollaborationwithintheSFMteam.Thesoftwareallowsteammemberstocommunicatewitheachotherinreal-time,ensuringthateveryoneisonthesamepageandawareofanychangesorupdates.Additionally,JanitorialManagerprovidesaplatformforsharingdocumentation,bestpractices,andfeedback,promotingknowledgesharingandcontinuousimprovement.ReportingandAnalysisJanitorialManagerprovidesSFMwithrobustreportingandanalyticscapabilities.Thesoftwaregeneratesreportssummarizingkeyperformanceindicators,suchascleaningfrequency,taskcompletionrates,andcustomersatisfaction.Byanalyzingthesereports,SFMcanidentifyareasofimprovement,makeinformeddecisions,anddrivecontinuousimprovement.(IISFMWilJanitorial S«thPnPart-RuJaxxir*SLirjunMvcvnunDtiUjhs-\kr^Remix>m*SouthPortP.trk-SkiNRemo.Mii*Luinu.Park(»<liSi-Wo«tvn»ReJiwni*XbirkV('iWiPari•\\ixivreRemount*'.injuryStomnnIXx^itv•\\onvixR»>mvm*LuimtiPaikHihSi\\ouvit»RtxnxmfNewQRcodesystemfordailyreports.Pag^«i>1<5l8l26SFMJanitorial Belowisadailysamplereport.EMPLOYEEAREASCANPUNCHREPORTReportgeneratedon11/14/2023at18:46pmPoweredbyJanitorialManagerFromDateToDate11/06/202311/10/2023TOTALSLocationAreaTypePunchTimeAbreu,LauraRestroomsAllisonPark-WomensRestroom*64thStreetStartCleaning11/10/202301:09PMBaptiste,EdelineRestroomsAllisonPark-MensRestroom*64thStreetStartCleaning11/10/202301:09PMFernandez,EusebioGarages*G-1:7thStreet-RampEndCleanings-11/10/202301:17PMFernandez,EusebioGarages*G-1:7tliStreet-RampStartCleaning11/10/202301:17PMBaptiste,EdelineRestroomsAllisonPark-MenReportsaretime-stamped.EndCleaning11/10/202301:24PMRamirez,JoseRestroomsLummusPark6thEndCleaning11/10/202301:25PMRamirez,JoseRestroomsMarjoryStonemanDouglas-WomensRestroom*StartCleaning11/10/202301:31PMAbreu,LauraRestroomsMid-Beach-WomensRestroom*53thStreetStartCleaning11/10/202301:32PMAbreu,LauraRestroomsAllisonPark-WomensRestroom*64thStreetEndCleaning11/10/202301:32PMBaptiste,EdelineRestroomsMid-Beach-MensRestroom*53thStreetStartCleaning11/10/202301:32PMFernandez,EusebioGarages*G-2:12thStreet-RampEndCleaning11/10/202301:46PMFernandez,EusebioGarages*G-2:12thStreet-RampStartCleaning11/10/202301:46PMBaptiste,EdelineRestroomsMid-Beach-MensRestroom*53thStreetEndCleaning11/10/202301:47PMAbreu,LauraRestroomsMid-Beach-WomensRestroom*53thStreetEndCleaning11/10/202301:48PMRamirez,JoseRestroomsSouthPointPark-MensRestroom*StartCleaning11/10/202301:49PM(IISFMWIIJonitorialPaB%«fe1<fP126 Ramirez,JoseRestroomsMarjoryStonemanDouglas-WomensRestroom*EndCleaning11/10/202301:49PMBaptiste,EdelineRestroomsIndianBeach-MensRestroom*46thStreetStartCleaning11/10/202301:52PMAbreu,LauraRestroomsIndianBeach-WomensRestroom*46thStreetStartCleaning11/10/202301:52PMFernandez,EusebioGarages*G-3:13thStreet-RampEndCleaning11/10/202301:58PMFernandez,EusebioGarages*G-3:13thStreet-RampStartCleaning11/10/202301:58PMGuzman,DarelyRestroomsLummusPark6thSt-WomensRestroom*StartCleaning11/10/202302:00PMGuzman,DarelyRestroomsLummusPark6thSt-WomensRestroom*EndCleaning11/10/202302:00PMGuzman,DarelyRestroomsLummusPark6thSt-WomensRestroom*StartCleaning11/10/202302:00PMPoB%<^1<5|8126(IISFM Belowisaweeklysamplereport.flitle:ServiceReportByDay(Mon13,Nov,2023,01:26PM)ReportDate:Mon13,Nov,2023,01:26PMDateRange:11/08/2312:00AM-11/12/2311:59PMFiltersBy:Customer:MiamiBeachLocation:ParksArea:All#OfScan:AreaLocationWed08Thu09Fri10Sat11Sun12CrespiParkMenRestroomsParks22200CrespiParkWomenRestroomsParks11111FairwayParkMenRestroomsParks23200FairwayParkWomenRestroomsParks11211FlamingoParkBaseballMenRestroomsParks00000FlamingoParkBaseballWomenRestroomsParks00000FlamingoParkFootballMenRestroomsParks10000FlamingoParkFootballW'omenRestroomsParks01000FlamingoParkPoolMenRestroomsParks00000lamingoParkPoolWomenRestroomsParks10000FlamingoParkSoftballMenRestroomsParks11000Pd$9rttM26(IISFM^■11Janitorial EMERGENCYREPONSESFMhasover40yearsofdealingwithemergencysituationsacrossallindustrytypes.Wearevaluedbusinesspartnerstofirstresponders(CityofMiamiBeach),criticalhealthcareinstitutions(BrowardHealth,Baptist),governmentagencies(MiamiInternationalAirport)andfullyunderstandtheimportanceofhavingrobustbusinesscontinuityplans,businessresumptionplans,anddisasterrecoveryplans.WeconstantlyperformBusinessImpactAnalysis(BIA)andperformtabletopexercisesbothinternallyandwithclientstogameplancertaineventsandhowwewillsupportclients.SFMisa24x7x365operation.Foremergencysituations,wewillworkwithclientstodiscussdifferentscenariosbutingeneralweoperateinthefollowingmanner:•WefollowStandardOperatingProceduresforEmergencies•AllSupervisorsandManagershavemobilephones,laptops,andaircardsforfullconnectivity.•DedicatedAccountManagersarealwaysoncall.•CallTrees(SFMandClient)areprovidedforanynecessaryescalations.•SupervisorshaveCompanyCars&CorporateCardsforanyemergencypurchases.•SupervisorshaveaccesstoSFMwarehousetodeployemergencyequipment,tools(blowers,dehumidifiers,etc.)•SFMutilizesMicrosoftTeamsforanyemergencyconferencemeetings.•Vendorrelationshipshavebeenestablishedforany3rdpartyneeds.SouthMiamiwillhaveaccesstoSFM'sManagementandExecutiveLeadership24x7.SFMwillrespondtoanemergencysituationwithin1hourofnotification.1stPOCPedroReus,AccountManagerDirectPh;:786.853.8338E-mail:preus@sfmservices.com*2ndPOCAlejandroDiCola,ProjectManagerDirectPh.:786.853.8332E-mail:adicola@sfmservices.com*3rdPOCPascaleLopez,GeneralManagerDirectPh.:786.663.2248E-mail:plopez@sfmservices.com*4thPOCIsraelRosado,COODirectPh.:786.914.1143E-mail:irosado@sfmservices.com5thPOCChristianInfante,PresidentDirectPh.:305.525.9442E-mail:cinfante@sfmservices.com<||sm^11JanitorialPf MANAGEMENTSTRUCTURESFMwillhave1dedicatedfull-timeAccountManagerand2zonesupervisorsforSouthMiami'sjanitorialoperations.Thiswillensurepropersupervisionandsupporttothejanitorialservicesdaily.PedroReushassuccessfullymanagedoneofourlargestcontractsforthepastfouryears.Pedro'sabilitytofamiliarizeandgainstaffallianceisessentialtoasmoothandsuccessfuljanitorialoperation.WeareconfidentthatMr.Reusisqualifiedtoassumemanagementofthecity'sjanitorialservices.PedroReus,AccountManagerSummaryofQualificationsOvertwentyyears'experienceingeneralmanagement.JOvertenyears'experiencemanagingastaffofover1,500.Thoroughknowledgeofmodernpracticesandtechniques,andtools,equipment,andmaterials,usedincustodialworkdirectlyrelatedtomunicipalbuildings.Strongknowledgeofoperationalcharacteristics,services,andactivitiesofmunicipalbuildings.v'DeepknowledgeofFederalrulesandregulationsaffectingdailyoperations,includingsafetyandsecurityregulationsandprocedures.Exceptionalknowledgeofsafeandefficientworkpractices.Extensiveknowledgeofrecordkeeping,reporting,andpurchasingprocedures.Immenseknowledgeoftheprinciplesofsupervision,training,andperformanceevaluation.v'Uncommonabilitytoimplementairportcustodialoperationsandmaintenanceschedulesandprograms.Remarkableabilitytodirect,superviseandtrainsubordinatesinairportcustodialmaintenance.Strongabilitytodetect,analyzeandtakeappropriateactiontocorrectmaintenanceproblems.JIn-depthabilitytokeepclearandaccuraterecordsandcommunicatebothverballyandinwriting.Soundabilitytoestablishandmaintaincordialandcooperativeworkingrelationshipswiththosecontactedinthecourseofwork.ExperienceSFMSERVICES,INC.PROJECTMANAGER2018-CurrentMr.Reusisinvolvedinnewcontractstartupsandassuresthejanitorialspecificationsinthecontractareonscheduleandexecuted.EULENAMERICAASMOMANAGINGDIRECTOR2016-2018&ASMOCABINSERVICEGENERALMANAGER2015-2016&2012-2014AstheManagingDirectorhewasresponsibleforallMIAoperationsrelatedtoSecurity,CabinService,RampandGSE.Hewasinchargeoftheadministrationandcontrolofresourcestocovertheneedsofthedifferentdepartmentsandtoensurethatoperationsreachestablishedgoals.AsaGM,hisresponsibilitiesincludedsecurityandcleanlinessofAAaircraftsinMIA.Thiswasa27/7operationcoveringanaverageof270flightsperdayandwascomposedofagroupofapproximately450employees.Strictcontrolofmanpowerandbudgetsestablishedtogivethecompanytherequiredfinancialresultsandtheclienttheoptimallevelofservices.Pa^Fi^26^11Janitorial SUPPORTTEAMOPERATIONSTEAMPROPOSEDORGANIZATIONALCHART&STAFFING(IISFM^11Janitorial TRANSITIONPLANjCLIENTNAMESTARTDATEIMPLEMENTATIONLEAD1CityofSouthMiamiT.B.D.PascaleLopezPurpose:Inordertoachieveaseamlesstransition,SFMimplementsa10-StepTransitionPlantailoredtoeachsiteundercontract.Eachlocationwillfollowthesametransitionplanwiththeonlyvariancebeingstaffinglevelspersite.Thepurposeofthisprocessistoensureaseamlessintegrationofserviceswhenreplacinganexistingserviceproviderorin-houseprogram.Goals:1.Deliverseamlesstransitionthatprovidesstep-by-stepinstructionforSFMoperations.2.Identifykeyresourcesfortransitiontasksandproposedoperatingmodel.3.Createaccountabilityfortransitionteammembers.4.HostinitialtransitionmeetingwithclientrepresentativesandSFMexecutivemanagementteam.5.CreateabaseofcommunicationandexpectedprotocolsbetweenSFMandclient.6.Timelycommencementandsuccessfulserviceimplementation.SiteAssessments:TheSFMtransitionteamwillmeetwithkeymembersofeachlocationandconductaninitialsiteassessment.Thescopeofworkincludesvariousaspectssuchassafetyandsecurityregulations,timefrequencies,wastedisposalsystems,andhightrafficareasthatrequirespecialattention.Inaddition,SFMwillalsodetermineprojectworkbudgetstoensureefficientplanningandexecution.OurRisk&SafetyManagerwillconductsiteassessmentsinordertodeveloptrainingprogramsforallemployees.Equipment:Equipment,chemicals,andothersupplieswillbedistributedbasedontheneedofeachlocation.OurproposedequipmentlistforthiscontractcanbefoundwithinourPreliminaryImplementationPlan"ProposedEquipmentPlan".SFMfollowsastandardizedcompanywidecleaningprogramwhichincludes(4)basicgreensealedcertifiedchemicalsaswellassuppliesthatwillbeutilizedateverylocation.Moreinformationontheseproductscanbefoundinthe"Equipment,Chemicals,andProducts"sectionofourproposal.TransitionMeetings:RegularlyscheduledmeetingswillbeheldbetweenSFMtransitionteamandthecustomer'sdesignatedrepresentative(s)duringtheinitialtransitiontoensuretherequiredlevelofserviceisbeingreachedconsistently.Typicalmeetingsare30daysprior,15daysafterstartup,30days,60days,and90days.Staffing:OurTeam'sprimaryobjectiveistomakeitaseasyandconvenientaspossiblefortheexistingstafftojoinourTeam.Thetransitionteamwillfacilitatethehiringofallqualifiedincumbentemployees.Oncestaffinglevelsareestablished,SFMwillutilizeitsownforcestocarryoutthescopeofwork.Initialtrainingwillincludeunderstandingofthenewscopeofworkcontractexpectations.fllSFMMlDIJonitorial Formoreinformationonincumbentstafftransition,pleaserefertothe"PlanstoInterviewIncumbentStaff"sectionofourproposal.SupportTeam:Additionalaccountmanagementandsupervisionwillbeprovidedduringthetransitionperiodandwillremainonsitetoachieve100%understandingofthescopeofwork.Additionalsupervisionisprovidedatnocosttoourcustomers.QualityControl:SFM'squalitycontrolprogramwillensurethattherequiredlevelofcleanlinessisreachedduringthetransitionperiodandmaintainedthroughout.QCofficerswillassessfacilitiesandcompletearoominventoryperareatocreateaQCinspectionformcustomizedtoyourlocation.Additionally,QCofficerswillconductunannouncedinspectionsinordertocapturethereal-timestateofoperations.SFMTRANSITIONTRACKERDocumentationofTransition:Thistransitiondocumentoutlinestheassignedtasksandduedatesforover50actionitemsacrossvariousdepartments.Bycoveringallsteps,fromuniformsandbadgingtopayrollandphones,weaimtoensureasmoothandefficienttransitionprocess.Eachdepartmenthasitsspecificresponsibilities,andcollaborationbetweendepartmentsiskeytoachievingasuccessfultransition.Pleaseseeattachedexample.HIgMAAToday'sDate:fillTransitionDate:S11W1DaystoTransition:9IIStAViCtS.INC.06.282110.01.21Statu*rSelectionTaskDescription(OWNER)RESPONSIBILITYampIetedProgressilndSchedComments(SAMPLE)»malUserwOcCD’1StartUpManagementFinalizeContractChristianInfanteChrisispreparingfinalcontractandsendingtoclientattorneyforexecution2StartUpManagementDistributecostsheetforSFMManagementChristianInfante3HumanResourcesAdvertse/PostPositionsforCleanersEdwirVHRWearecurrentlyrecruitingwithinduetothelivingwage4StartUpManagementIdentifyTransitionTeamMembersPascaleLopezEdwin,Alejandro,Jeurys,Christian,Betty,Laz,JoeandClaudio5StartUpManagementCustomizeTransitionReport/ChecklistPascaleLopez6StartUpManagementDefineTransitionPeriodPascaleLopezTargetDate10.15.21stillnotcnfirmedbyclient7StartUpManagementCreateEquipmenthventoryPascaleLopez8StartUpManagementArrangemeetingbetweenSFM&ClientManagementTeamsChristianInfanteWeeklymeetingarecurrentlybeingheld.9StartUpManagementConfirmClientGoals&ObjectivesChristianinfanteChrisandPascalemetwithMGMTandconductwalkthru10HumanResourcesObtainrosterofincumbentemployeesChristianInfanteNotapplicable11StartUpManagementVerifyClientContactsPascaleLopezTonywillbeourPOC12StartUpManagementIdentifyOnsiteStorageSpaceEdvrin/PascaleEdwinandTonywalkedandconfirmedthespaceforcontainandemergencystockontheproject13StartUpManagementIdentifySFMProvidedEquipment(Phones)PascaleLopez2cellsneededforproject1forleadand1for2ndporterwillrequestfromEric14HumanResourceshterview/HireStaff(Staff)EdwirVPascale15HumanResourcesProvideNewHirePackets&Forms-EEFileElizabeth16HumanResourcesConductBackgroundChecksElizabeth17StartUpManagementOrderSuppliesandEquipmentPascaleWillbeorderbyFriday18Accounting&FinanceEstablishClientsPaymentTermsElizabettvBetty<||SFMWilJanitorial 60DAYTRANSITIONTIMELINETransitionTaskWeeksbeforeStartDate-8-7-6-5-4-3-2-1DevelopmentofContractProfileMobilizationofTransitionTaskForceRecruitmentofPersonnel/IncumbentCandidateInterviewsBBackgroundChecksEmploymentOffersSiteSurveysL1LUniformsandEquipmentorderedKeyPersonnelTrainingNewHireTrainingDevelopmentofMasterScheduleandAssignmentsUniformsandEquipmentissuedEquipmentandformsplacedonsiteOn-SiteTrainingContractcomplianceandqualitycontrol(weeklystatuscalls&meetings)(IISFM"lljonitorialPd^rtl»26 PRELIMINARYIMPLEMENTATIONPLANI.IMPLEMENTATIONTEAMRole:operationalmanagement&support,clientexpectationsmeeting,customersatisfaction.Role:coordinateallspecialprojectsincludingfloorcareandpressurecleaning.Role:operationalmanagement&support,clientexpectationsmeeting,customersatisfaction.Role:contractnegotiations,corporatesupport,clientexpectationsmeeting,customersatisfaction.Role:Recruitment,EmployeeBackgroundChecks,DrugTesting&NewHireSet-Up.Role:riskmanagement,siteorientation,employeesafety&training.AlejandroDiColaPhone:786.853.8332Email:adicola@sfmservices.comIsraelRosado,COOPhone:786.914.1143Email:irosado@sfmservices.comLuisSanchez,Risk8cSafetyManagerPhone:786.547.6704Email:lsanchez@sfmservices.comChristianInfante,PresidentPhone:305.525.9442Email:cinfante@sfmservices.comPedroReus,AccountManager(TransitionLead)Phone:786.853.8338Email:preus@sfmservices.comPascaleLopez,GeneralManager(TransitionLead)Phone:786.663.2248Email:plopez@sfmservices.comRole:programimplementation,employeeorientation,supplyorders,off-sitetraining,andservicedelivery,operationsmanagement,clientexpectationsmeeting,customersatisfaction.BarbaraFindo,DirectorofHumanResourcesandSafety.‘IIPhone:786.246.0102wEmail:bfindo@sfmservices.com<||SFM11JanitorialPaW^^?8l26 II.EXPECTATIONSMEETINGTheResources:PedroReus,AccountManagerPascaleLopez,Corporate/ContractSupportBarbaraFindo,DirectorofHumanResourcesandSafetyTheProcess:AsstandardtransitionprotocolSFMwillsetupanexpectationmeetingbetweenSFMOperationsandSouthMiamiDesignee(s)toestablishallparties'goalsandexpectationsforthefirst60-daysofservices.Thepurposeofthismeetingisto:•Definecommunicationchannels(WhodoIcallfor?)•Identifyindividualrolesandresponsibilities•Establishstandardizedinspectionreport•IdentifyspecificneedsandrequirementsofClient•DetermineSFMevaluationcriteria•Culturalintegration(safety,management)•Establishinvoicingstructure•Identifystorageareas•IdentifyuniformrequirementsIII.ONSITEORIENTATIONResources:PedroReus,AccountManagerPascaleLopez,Corporate/ContractSupportBarbaraFindo,DirectorofHumanResourcesandSafetyTheProcess:Step1:DetailtourofSouthMiamilocations.Step2:Developworkschedulesandbudget.Step3:Identifyequipmentandsuppliesneededpersite.Step4:Identifypotentialcontractualgaps.Pa^rtt?8|26<||SFMWilJanitorial IV.ORDEREQUIPMENT&SUPPLIESResources:PedroReus,AccountManagerTheProcess:Step1:SubmitorderforcapitalequipmentStep2:Submitmisc.supplyordersPROPOSEDEQUIPMENTPLANPROPOSEDEQUIPMENTAllsiteswillbeequippedwithstandardnecessaryequipment.(Mops,mopbuckets,microfibercloths,maidcarts,Brutbarrels,uprightvacuumcleaners,backpackvacuums,etc.)SFM'sstandardmanufacture/brandscompanywideareRubbermaid,Advance,andSpartan.Stieswillhave(1)standardbiohazardkit.SFMhasincludedallconsumablesupplies:Toiletpaper,handtowels,toiletseatcovers,&handsoap.Siteslargerthan25,000sqfthaveseveralcommercialwideareavacuums.>SafetyDataSheets(SDS)aretobeprovidedforeachjanitorcloset.<II»MPaW^^26 V.EMPLOYEESCREENING&HIRINGTheResources:PedroReus,AccountManagerBarbaraFindo,DirectorofHumanResourcesandSafetySophiaCasas,LeadRecruiterTheProcess:OurTeam'sprimaryobjectiveistomakeitaseasyandconvenientaspossiblefortheeligibleexistingstafftojoinourTeam.SFMwillalsoUtilizeSFM'snetworkof1,000+employeesinlocalmarket,coordinateinterviewswithincumbentemployees,utilizeonlinedigitalplatformssuchasZipRecruiterandsocialmedia.SFMalsoplacesadvertisementsinthelocalpaperifnecessary.Step1:Openemployeerequisitions.Pleaseseeenclosedemploymentrequisitionform.Step2:AdvertiseRoles(positions)Step3:HoldjobfairsStep4:EmployeeapplicationreviewStep5:Identifycandidatesandperform2PanelInterviewProcess.•PedroReus,AccountManager•BarbaraFindo,DirectorofHumanResourcesandSafety•SophiaCasas,LeadRecruiterStep6:ShannonMelendiAct/Level2CriminalbackgroundcheckandDrugscreeningStep7:Makeofferofemploymenttoallnewhiresand1-9verificationandcompleteonboardingprocess.PLANSTOINTERVIEWINCUMBENTSTAFFIneffortstopromoteasmoothtransitionfortheincumbentemployeestojoinourteam,wewillholdlocaljobfairsaswellasseektheuseofaconferenceroomonscheduleddatesinSouthMiamiCityHall.Onceasenioritylistisobtainedwithcontactinformation,weshallalsomailinformationtoallincumbentstaffandcontactthembytelephone.Aspartofourinterviewingandhiringprocess,wewillofferqualifiedincumbentemployeestheapplicablepositionsrequiredunderthescopeofservicesoftheAgreement.Ourteamwouldbegincontactingtheincumbentstaffwithinthefirstweekaftertheformalawardannouncement.Assuringthestaffthattheyhavejobcontinuationattheircurrentwageandbenefitstructurenotonlyletsthemknowthattheywillbejoiningaprofessionalservicecompanybutonethatcaresaboutitsemployees.^■11JanitorialPa^WfIM26 EmploymentRequisitionForm<||SFMSFMJANITORIALSERVICESEMPLOYMENTPREREQUISITEFORMThisformmustbecompletelyfilled.NEWHIRERE-HIRETRANSFEREmployeeName:—IDNo.:EffectiveDate:—Position:Rate:Location.PREREQUISITES:(CHECKOFFALLREQUIREDPERPOSITION)LEVEL2BG7YRSBIOHAZARDWASTEHANDLINGDRUGTESTPPEUSEBLOODBORNEPATHOGENTRAININGCLEANCHECKTRAININGTERMINALCLEANING(OR)TRAININGINCIDENTREPORTINGHIGHDISINFECTIONTRAININGCUSTOMERSERVICETRAININGSLIPANDFALLPREVENTIONFLUSHOTTBSHOTHIPPATRAININGOTHERFOROFFICEUSEONLYGIVENGIVENEMPLOYEEIDYESN/APHONEAND/ORRADIOYESN/APAYCOMACCESSYESN/ASUNPASSYESN/AUNIFORMSYESN/AGASCARDYES0N/AKEYSYESN/AFOBYESN/ALAPTOPYESN/APHONEAND/ORRADIOYESN/AManager/Supervisor.Signature:DateHRRepresentative:Signature:Date:Pd^84^26SFMJanitorial VI.EMPLOYEETRAININGResources:PedroReus,AccountManagerBarbaraFindo,DirectorofHumanResourcesandSafetyLuisSanchez,Risk&SafetyManagerTheProcess:Step1:LuisSanchez,Risk&SafetyManagerwillprovidetrainingtoallemployeesTopicsincludebutarenotlimitedto:JPPEandproperuseBloodbornePathogensExposureControlPlanJGeneralOperationalProceduresRespiratory/coughetiquetteSiteorientationJSDSJWastehandlingSpecialproceduresHazardousMaterialsJPatientexperienceJPropercommunication&documentationtechniquesHandHygieneHandlingtextile/laundryMaintenancechecklistsv'EnvironmentalcleaninganddisinfectionDepartmentalPoliciesJUniversalPrecautionsAllemployeesmustreceivesuccessivelevelsoftrainingatthevariouslevels.Evenseasonedmanagersspendtimebeingretrainedwithnewproductsandequipmenttechnologyatalllevelstostayaheadofnewindustrydevelopmentsandtrends.Ourtrainingprogramsuseacombinationofclassroomandhandsonexperience.VII.SETUPWEB-BASEDQUALITYCONTROLINSPECTIONSYSTEMTheResources:ChristianInfante,Corporate/ContractSupportIsraelRosado,Corporate/ContractSupportBarbaraFindo,DirectorofHumanResourcesandSafetyQualityControlOfficer(s)(IISFMWliJanitortaiPaV?##326 VIII.INVOICINGTheResources:PedroReus,AccountManagerPascaleLopez,Corporate/ContractSupportChristianInfante,Corporate/ContractSupportVilmaSantos,AccountsReceivable&BillingCoordinatorA/RPh:305.818.2424Email:arjanitorial@sfmservices.comTheProcess:Step1:Reviewcontractandloadinformationintobillingsystem.Step2:Prepareandsendmockinvoiceforreviewandapproval.IX.SERVICESTARTUPTheResources:PedroReus,AccountManagerPascaleLopez,Corporate/ContractSupportBarbaraFindo,DirectorofHumanResourcesandSafetyStep1:Rolloutdate:T.B.D.Step2:Identifyspecificstartupdaytasks>PascaleLopez,JanitorialManager•Projectmanagementsupport•Ensureproperstaffinglevels•Superviseassignedlocations>SiteSupervisor>SupervisePorters<||SFM^111Janitorial X.FOLLOWUPMEETINGSTheResources:PedroReus,AccountManagerPascaleLopez,ContractSupportChristianInfante,Corporate/ContractSupportIsraelRosado,Corporate/ContractSupportTheProcess:Step1:Reviewtheclient'ssatisfactionwiththetransitionprocess.Step2:Identifyareasofimprovement.Step3:Makenecessarystaffingadjustments.Face-To-FaceMeetings-InitialStartUp,MonthlyThenQuarterly(||SFMWIIJanitorialPatH843^26 8.EQUIPMENT,CHEMICALS,ANDPRODUCTSSFMFLEETSFMhasacomprehensivemaintenanceprograminplacetoensurethatitsfleetandequipmentarewell-maintainedandfunctioningoptimally.Toachievethis,wehaveourFleetManagerAlbertoSalonesalongwithateamofthreefull-timemechanicswhoarededicatedtooverseeingthemaintenanceandupkeepofthefleetandequipment.Theirprimaryresponsibilityistoensurethatallequipmentisintopcondition,minimizingdowntimeandmaximizingoperationaleffectiveness.Additionally,SFMutilizesWhipAround,aweb-basedfleetmaintenancesoftwarethatallowsustotrack,document,andreportvitaldataweneedtooptimizetheperformanceofourfleetandheavyequipment.Everydrivercompletesapre-tripinspectiondailyasapreventativemaintenancemeasure.WhipAroundalsotracksfuelusageandintegrateswithourvehicletrackingsoftware,GEOTAB.whiparoundSFMhasamaxlifeequipmentpolicyunderwhichequipmentisreplacedonceithasexpireditslifeexpectancy.ThisensuresthatSFM'soperationsarenothinderedbyoutdatedormalfunctioningequipment.Byimplementingthispolicy,SFMisabletomaximizethelifespanandperformanceofitsequipment,leadingtoincreasedefficiencyandproductivity.Inadditiontomaintenance,SFMhasarobustwarehousesysteminplacetostorealargeinventoryofjanitorialequipmentandsupplies.Thisfacilityspansover20,000squarefeet,providingamplespacetostoreallthenecessarymaterialsrequiredforthesmoothoperationofSFM'sservices.Bymaintainingalargeinventoryofjanitorialequipmentandsupplies,SFMensuresthatitsoperationsarenotdisruptedduetoequipmentbreakdownorsupplyshortages.ThisproactiveapproachtoinventorymanagementenablesSFMtorespondpromptlytocustomerneeds,ensuringthatservicesaredeliveredefficientlyandeffectively.Pdy^S<^26 SUPPLIERSVeritivhasbeenSFM'strustedsupplierforover15yearsnow.Throughthispartnership,SFMhasgainedaccesstothefullrangeofVeritiv'sofferings,includingtheirextensiveinventoryofjanitorialsupplies.ThisallowsSFMtomeetthediverseneedsoftheirclientsandensurethattheyhavethenecessaryproductstomaintainacleanandhealthyenvironment.Veritivisoneofthenation'slargestjanitorialsupplydistributors.Withastrongpresenceintheindustry,Veritivhasaccesstoawiderangeofsuppliersandcansourcehigh-qualityproductsatcompetitiveprices.Veritivisanindustryleaderingreencleaninginitiatives.Theyprioritizeenvironmentalsustainabilityandimplementpracticesthatpromotetheuseofenvironmentallyfriendlycleaningproducts.BypartneringwithVeritiv,SFMhasaccesstoeco-friendlycleaningsolutionsthathelpbusinessesreducetheircarbonfootprintandcomplywithsustainabilitystandards.Whetherit'sjanitorialpowerequipment,personalprotectiveequipment,chemicals,orconsumables,Veritivisourreliablesource.Nilfiskxs#AdvanceIPCEagleSanitaireISKKRCHERby3Electrolux^TeamTheVacuumCompany(IISFM^11Janitorial CHEMICALSInanefforttoensureconsistencyandmaintainthehigheststandardsofcleanliness,SFMhasstandardizeditscompanywidecleaningservicesbyutilizingfour(4)basicchemicals.ThesechemicalshavebeencarefullyselectedfortheireffectivenessandareGreenSealCertified.Byimplementingthisstandardizedapproach,SFMensuresallaccountsreceiveaconsistentcleaningexperienceusingeco-friendlyproductsaswellasastandardizedcleaningmethodthatcanbereplicatedacrossmultiplesites.S^nSOLUTIONSNeutralFloorCleanerDisinfects,&Deodorizes(IISFM^11Janitorial SAFETYDATASHEETS“SDS”Currently,SFMisworkingwithMSDSOnline,aweb-basedcentralizedmanagementsystemthatwilldigitizeourSafetyDataSheets.SDSbinderswillbeathingofthepast.Notonlydoesthisminimizeourcarbonfootprint,butitalsoensuresthatouremployeeshavereal-timeaccesstothelatestsafetydatasheetsforthechemicalsbeingusedwhilemeetingOSHAcompliance.BelowareSDSlinkstothefourstandardchemicalsusedtocarryoutdailycleaningaswellasothercleaningproductsusedinhealthcareenvironments.1.CleanontheGoCleanbyPeroxyNo.15https://www.spartanchemical.com//sds/downloads/AGHS/EN/4820.pdf2.CleanontheGoBiorenewablesGlassCleanerNo.18https://www.spartanchemical.com//sds/downloads/AGHS/EN/4835.pdf3.CleanontheGoNABCConcentrateNo.1https://www.spartanchemical.com//sds/downloads/AGHS/EN/4716.pdf4.CleanontheGoTribaseMulti-PurposeCleanerNo.17https://www.spartanchemical.com//sds/downloads/AGHS/EN/4830.pdf5.CloroxHealthcare®SporelODefense™CleanerDisinfectanthttps://www.thecloroxcompany.com/wp-content/uploads/2020/06/Clorox-Healthcare%C2%AE-SporelO-Defense%E2%84%A2-Cleaner-DisinfectantMultilingual2.pdf6.CloroxHealthcare®FuzionCleanerDisinfectanthttps://www.thecloroxcompany.com/wp-content/uploads/2020/06/Clorox-Healthcare%C2%AE-Fuzion-Cleaner-DisinfectantMultilingual2.pdf7.CloroxHealthcare®BleachGermicidalWipeshttps://www.thecloroxcompany.com/wp-content/uploads/2019/Q2/Clorox-Healthcare%C2%AE-Bleach-Germicidal-Wipes.pdf8.CloroxCommercialSolutions®Clorox®Total360®DisinfectantCleanerlhttps://www.thecloroxcompany.com/wp-content/uploads/2019/09/Clorox-Commercial-Solutions%C2%AE-Clorox%C2%AE-Total-360%C2%AE-Disinfectant-Cleanerl.pdfPa$§8^26WilJanitorial MICROFIBERTECHNOLOGYGeneralCleaningMicrofibermaterialcanholdmorethan5timesitsweightandhasanexceptionalabilitytoabsorbgreaseandoils.Italsodoesnotleaveanydustorlintbehind.Thesepropertiesreducethenumberofbacteriaonasurfaceby99%.WashMops&ClothsonSiteSmallwashingmachineswillbeinstalledinjanitorclosets.Thishelpspreventcleaningstafffromreusingsoiledmops&cloths.Machinemeasures29"Highx17"Width.Installationtobedonebyclient.>SFMwillinstallthesemachineswherepossible.(IISFMIIJanitorial EQUIPMENTLISTBelowisageneralequipmentlisttypicallyutilizedforthissizecontract.EquipmentKeptOnsiteFloormachinePacesetter20TS*•MaxProductivityat3.5mph-Perhour:41,580sqft/hr•Weight-87lbs•PadMotor-1.5hpDCRectified•PadDriversize-20in•PadDriverspeed-180/320rpmPressureCleaner3000PSI1.1GPMElectricPressureWasher4•Ryobi3000PSI1.1GPM•13AmpElectricMotor•Gun/WandAssemblywithquickconnects•20'UltraFlexHoseFloorFansAdvanceAM2400DAirMover••Threespeedsettings•Poweroutletfordaisychaining•Circuitbreaker•Ergonomiccarryinghandle•Durablerotomoldhousing•Powerfulmotorsuppliesupto2,400CFMairflowFloorHEPAVacuumCleanMaxCMNR-QD•HEPAFilter•107CFM•PowerCordLength40Feet•40',SJT,3-wirepigtailpowercordgllSFMIIJanitorialPd^Wl^26 GeneralEquipmentUtilizedCompanywideElectrostaticSprayerClorox®Total360®System-ElectrostaticSprayer•100%Coverageonallsurfaces•KillsC.diffin5minutesand38additionalbacteria,virusesandfungiin1minute•Inhibitsthegrowthofmoldandmildewforupto7days•Lowodor,noaddedfragranceLitterToterwithstorageoptionsRubbermaidMaidCartRubbermaidWaveBrake®35Qt.YellowMopBucketwithDownPressWringerandRedDirtyWaterBucket<||SFM^11JanitorialPa^Pft?8|26 (IISFMW11JonitoriolFloorCareEquipmentUtilizedbyFloorCareTeamPressureCleanerLandamhps3500trailermounted«jl•Weight-1,000lb•15"white-rimmedwheels,1,000lb•Axle-Single-axis•Watertank-330gallonsBurnishersNilfiskAdvanceAdvolutionJ•Perspeed-1,500rpm•PadMotor-1.5hp•Cord-75ft•PadDriver-20inpaddrive•Weight-85lbExtractorViperwolfcarpetspotter1.>U•30PSIpump,85"ofwaterlift•Comesw/8'hose&carpetgroomingtool•1gallonsolution/1gallonrecovery•Weighs-24lbsWet/DryVacuumEttore90007windowcleanersAX•Single1.17HPvacuummotor•18gallonrecoverycapacity•95CFM,110"ofwaterlift•9'x1.5"recoveryhose•Comeswithafrontmountsqueegee&accessorykit^26 FLOORCARESFM'sFloorCareProgramspecializesinprovidingqualityfloorcleaningservicesforalltypesoffloorsurfaces,includingcarpet,terrazzo,VCT,concrete,andmore.Ourdedicatedteamofexperiencedprofessionalsusethelatesttechniquesandequipmenttodeliverexceptionalresults.BelowisanexampleofSFM'sfive-stepprocesstorestoreTerrazzoandMarbelfloors.1.StrippingInthisprocesswaxes,sealer,andresidueareremoved.2.RepairTherepairprocessincludesfillinginchips,nailholes,smoothandremovestainsfromthesurface.3.GrindingThegrindingprocessproceedswithaseriesofincreasinglyfinediamondsuntilthefloorissmoothandfreeofvirtuallyallsurfaceimperfections.4.PolishingAcidpowderisdistributedacrossthefloor,whichisthenmixedwithwaterandpolishedbyaspecializedmachine.Thismethodeffectivelyingrainsthepolishontothesurfaceoftheterrazzofloorbelowandkeepsthesurfacesmoothandlevel.5.CrystallizationThecrystallizationprocessprovidesahighglossfinishonthemarble/terrazzosurface.BelowareactualbeforeandafterprojectscompletedbytheSFMFloorCareTeam.TerrazzoRestorationO||SFM^11JanitorialPd^WJ FloorCareEquipmentPolishingpowder.3MScotchBritediamondpurplepad.Grindingdiamondpads.RDustmop.Handledoodlebug.Floorneutralizer3MBlackStripperPad.Floorscraper.MicrofibermopBucketmopFloorSqueegeePd^rt^26(IISFM”11Janitorial SUSTAINABILITYANDRESILIENCYSTEWARDSHIPSFMistheidealpartnertopromoteandenhanceitsEnvironmentalPolicy.NotonlydoweofferGreenSeal-certifiedchemicalsandcleaningmethodsaspartofourstandardjanitorialservice,butwe'vealsohelpedourclientsachievetheirenvironmentalgoals.SFMhasbeenproviding'green'focusedcleaningservicestotheSouthFloridaareaforover20yearsandisconsideredaleaderingreenandsustainablejanitorialservices.AtSFM,webelieveeveryonecandotheirpartinsavingtheenvironment.Therefore,SFMsupervisorsandcrewmembersaretrainedtoimplementandcarryoutLEED-basedcleaningbestpractices.Thesebestpracticesinclude:•Useofmicro-fibertoolstocaptureandremovedirt,germs,andbacteriafromsurfacesandtopreventcross-contamination.•TrainingandsupervisionofSFMcrewsintheuseofenvironmentallypreferredproductsandsustainablepractices.•UtilizationofCRIlabeledvacuumswithHEPAfilters.•Useofenvironmentallypreferred&third-partycertifiedproductssuchasGreenSeal,EcoLogo,DfE,andGREENGUARD.•Monitorcomplianceandefficiencythroughmonthlysitesurveys.•Supportofrecyclingprograms.•PreferenceforrapidlyrenewableorrecycledpaperproductswithGreenSeal,EcoLogoand/orChlorineFreeProductCertifications.•Encourageuseofentrywaymattingmadeofrecycledmaterialstoreducesoilenteringafacility,therebyreducingairbornecontaminants.•Useoffloorcaresolutionsandfinishesthatareenvironmentallyfriendly.SFMhasservicedsomeofthelargestLEEDbuildingsinSouthFlorida,includingthe347KSFBaptistWestKendallHospital.SFMcurrentlyservicesthe674kSFMiamiTower,oneofthetallesthigh-risebuildingsinFlorida.WealsoserviceLEEDmunicipalbuildingsliketheCityofCoralGablesPublicSafetyBuilding.BecomeaUSGBCmembertoday.JCredentialsEducationMcnibcrsnpLLEDBD’CHcaConstruction,v-i-LEED.-:CityofCoralGablesPublicSafetyBldgProjectInfoSize189DOOsoftPa^WSf|SFMWilJanitorial SFMiscommittedtominimizingourimpactontheenvironmentandpromotingsustainablepracticesthroughoutouroperations.ThisSustainabilityandResiliencyPlanoutlinesourcommitmenttoutilizingenvironmentallypreferablecleaningpractices,chemicals,equipment,andsupplies,ensuringthatwemaximizetheirefficiencyandimpact.EnvironmentallyPreferableCleaningPractices1.WaterConservation:Weprioritizewaterconservationbyimplementingmeasuressuchaslow-flowfixtures,waterlessurinals,andhigh-efficiencyvacuumsystems.2.EnergyEfficiency:Weinvestinenergy-efficientequipment,suchasLEDlighting,EnergyStar¬ratedappliances,andprogrammablethermostats.3.WasteReduction:Wepromoterecyclingandcompostingprogramstoreduceourwasteoutput.Additionally,weutilizebiodegradableandrecyclablesuppliesandcontainerswheneverpossible.4.Eco-FriendlyProducts:Weprioritizetheuseofeco-friendlycleaningproductsthataresafeforpeopleandtheplanet.5.GreenCleaningTechniques:Weincorporategreencleaningtechniquessuchasmicrofibercloths,HEPAfilters,andelectrostaticsprayerstominimizechemicalusage.6.ChemicalManagement:Weadheretostrictchemicalmanagementprotocols,includingproperhandling,storage,anddisposalofhazardousandnon-hazardoussubstances.EnvironmentallyPreferableChemicals1.GreenSealCertifiedProducts:WeprioritizetheuseofGreenSeal-certifiedchemicals,whichrepresentthehigheststandardforenvironmentalsustainabilityandhumanhealth.2.Non-ToxicandLowVOC:Weselectcleaningproductsthatarenon-toxicandhavelowvolatileorganiccompounds(VOCs),reducingtheirenvironmentalimpact.3.RecyclablePackaging:Weprioritizetheuseofrecyclablepackagingforourchemicals,minimizingwasteandpromotingacirculareconomy.EnvironmentallyPreferableEquipmentandSupplies1.Energy-EfficientEquipment:Weinvestinenergy-efficientequipment,suchasEnergyStar¬ratedvacuumcleanersandscrubberdryers,toreduceourenergyconsumption.2.ReusableandRefillableSupplies:Weoptforreusableorrefillablesupplies,suchasspraybottlesandmopbuckets,tominimizewasteandpromoteacirculareconomy.3.BiodegradableMaterials:Weprioritizetheuseofbiodegradablematerials,suchasmicrofiberclothsandcompostablebinliners,toreduceourecologicalfootprint.tW26<||SFM^11Janitorial 9.POLICIES&PROCEDURESHUMANRESOURCESPROGRAMForover30yearsnow,SFMhasofferedconsistentwork,keepingourpoolofapplicantsfulloflocalenthusiasticpersonalities.Usingourregionalemploymentrecruitmentstrategies,SFM'sexperiencedrecruitmentteamwilltargetlocalresidentsforemploymentopportunitiesthusfosteringcommunityinvolvementanddevelopment.SFMisknownforitslocalemploymentopportunitiesthroughoutSouthFloridaandwearetrulyaLOCALbusinessthatcanboastaboutgivingbacktothecommunitymorethananyothervendor.Havingawell-trainedandorganizedstaffisessentialtomaintenanceoperations,andeveryonewhoisonourteamplaysanintricateroleinthesuccessfuloperationsofeveryproject.AtSFM,ouronboardingprofessionalsand“HireCharacter,TrainSkill”managementteampreparehundredsofqualifiedindividualstosuccessfullycarryouttheirdailyassignments.SFMemployeesaretrained,uniformed,andfullyequippedpriortotheirjobassignmentassuringeffectiveperformanceasspecifiedbyourclient.Inthepast,humanresourcesprofessionalsfocusedprimarilyonadministrativetaskssuchasfindingqualifiedemployees,matchingthemtoappropriatejobs,andbalancingtheinterestsoftheorganizationwiththerightsandneedsofemployees.Today,therolesofHRprofessionalshaveevolvedtosupportanorganizationinreachingitsstrategicgoalsandimprovingbusinessresults,whilecultivatingtalentedandcapablestaff.Simplyunderstandinghumanresourcesmanagementterminology,conceptsandprinciplesjustdoesn'tcutittoday.Ourtalentedmanagersdesignandimplementhumanresourcesmanagementpoliciesthatsupportourorganization'sstrategicplanforgrowthand"Brand"recognition.Theyservetoenhanceourorganization'sabilitytoattract,motivate,develop,andretaineffectiveemployees,whichisparamounttoourclientretentionthroughqualityserviceandgrowththroughreputation.Pd^Vf<||SFMWIIJanitorial SFM’SHIRINGFORMATDescribedbelowisadetailedplanforhiring,retaining,andtrainingthatidentifiesthemethodsforensuringSFM'sstaff,includingmanagementpersonnel,aremaintainingindustrystandardsintrainingandbestpractices.SFMServicesperformsLEVEL1&LEVEL2investigativebackgroundchecksforallemployeesstaffingourclient'sfacilities.Ourinvestigativebackgroundchecksincludethefollowing:PeopleFactsJSocialSecurityNumberVerificationV"CriminalHistorySearch(7years)JTerroristWatchListJEmploymentVerificationJViolentSexualOffenderRegistrySearchSDMVRecords(7years)FloridaHRSAbuseRegistrySFMemployeefilescontainhealthchecksandrequiredtestingaswellasdocumentedtraininganddevelopmentcompliantwithOSHA.OSHAEMPLOYEETRACKINGAlldriversforSFMareregisteredwithSambaSafety.SambaSafetygivesusthesecurityofknowingthatourdriversarecontinuouslybeingmonitoredwhileonandoffthejob.Theirsystemalwaysencouragesouremployeestodrivesafely.sambasafetyAllSFMVehiclesareequippedwiththe"GeoTab"GPStrackingsystem.Thisensuresourdriversareservicingalllocationsandwilltellushowmuchtimeisspentateachlocation.GEOTAB.....Dispatch10Driving40mphon4/14/19at10:13:12myGEQTABL>„0-o-fllSFM^11JanitorialPa^rtW8|26 HIRINGMETHODOLOGYStep1:UtilizeSFM'snetworkof1,000+employeesinthelocalmarket,coordinateinterviewswithincumbentemployees,utilizeonlinedigitalplatformssuchasZipRecruiterandSocialMedia.SFMalsoplacesadvertisementsinthelocalpaperifnecessary.Step2:Identifyprojectsupervisorcandidatesandperform2PanelInterviewProcess.Step3:Hiresupervision.Step4:Employeeapplicationreviewandjoborientation.Step5:CriminalbackgroundcheckandDrugscreening.Step6:Makeofferofemploymenttoallnewhiresand1-9verification.Step7:LuisSanchez,Risk&SafetyManager.ProvideNewHireTraining.AssurancePersonnelAvailabilitySomepositionsinthiscontractwillbepart-time.Thiswillallowustohaveapoolofback-upstaffoncallthatwillalreadypossessthenecessaryqualifications,training,andexperiencetocarryouttheirwork.BACKGROUNDCHECKSAsastandardpractice,ourTeamwillrunlevel1&2federalbackgroundchecks——(nationwidecheckinvolvingallstates)onallitsnewhiresasrequired.=VerifyEmployeesrequiringaccesstofederallyregulatedsecureareaswillundergoindividualbackgroundscreening.Whenitcomestoassumingaclient'sstafforfillinganopenpositionforthem,weareflexible.Wehavefoundthatbackgroundresearchstandardsoftenvarybyclientchoice.Someclientsareinvolvedinspecializedhiringprograminitiatives.Inthesesituations,wefirstconsulttheclientastothedepthofreportdesired(city,county,stateorfederal)andrunreportsuponmutualagreementwiththeclient.WehaveutilizedthesameFCRA(FairCreditReportingAct)compliantproviderforover5yearsandhaveandhavehadnoincidentsofincorrectorfalseinformation.ForthiscontractSFMwillnothireanyemployeewho:>Hasbeenconvictedofaviolentfelonyorconspiracytocommitaviolentfelonywithinthepastfive(5)years;>Hasbeenconvictedofafelonyinvolvingthetraffickingofacontrolledsubstancewithinthepast(5)years;>Hastwo(2)ormoreconvictionsforaviolentfelony,forconspiracytocommitaviolentfelony,orinvolvingthetraffickingofacontrolledsubstance;>Isasexualoffenderorasexualpredator;>HasfailedtoprovideproofofUnitedStatescitizenshiporlegalimmigrationstatusintheUnitedStates.PaW^^26fllSFM^11Janitorial EMPLOYEESATISFACTIONANDRECOGNITIONPROGRAMSFMJanitorial'sEmployeeSatisfactionandRecognitionProgramaimstocreateapositiveworkenvironmentandacknowledgethehardworkanddedicationofouremployees.Weunderstandtheimportanceofemployeesatisfactioninachievingorganizationalsuccessandbelievethatrecognizingtheireffortsiscrucialinfosteringmotivationandloyalty.Werecognizeemployeesinmultipleways:4EmployeeoftheMonth4-Spotbonusesforpositiveclientfeedback4-EndofYearbonusforselectstaff4SafetyBBQ's/PicnicsifSafetyGoalsareachievedSpotbonusesforachievingExcellentQualityControlresultsSFMemployeesareofferedthefollowingbenefits:Immediately4Overtimepayrateifcertainholidaysareworked.4-Safetyrewardsandbonuses.4Freeuniforms.4Directdeposit.Afterthe90-Dayprobationperiod.4HealthInsurance.4FreeLifeInsurance4LifeworksEmployeeAssistanceProgram4Safetyrewards&bonuses.4Continuededucation.4Careeradvancementopportunities.After1-Yearofemployment.4Enrollmentinto401Kprogramforsupervisorsandmanagers.4Paidtimeoffforsupervisorsandmanagers.Pa^1«t)l<fPl26<||SFMMHJanitorial DRUGFREEWORKPLACEPROGRAMSFMISPROUDTOPARTICIPATEINTHENATIONALDRUGFREEWORKPLACEPROGRAM.Itisourdesiretoprovideadrugfree,healthy,andsafeworkplace.Topromotethisgoal,employeesarerequiredtoreporttoworkinappropriatementalandphysicalconditiontoperformtheirjobsinasatisfactorymanner.Whileonouraccountpremisesandwhileconductingbusiness-relatedactivitiesoffpremises,noemployeemayuse,possess,distribute,transfer,sell,orbeundertheinfluenceofalcoholorillegaldrugstohelpensureasafeandhealthyworkingenvironment.Muchlikeseatbeltswithautomobiles,Insurancecompanieshavestringentrequirementsinthecoveragetheyprovide.Jobapplicantsandemployeesmaybeaskedtoprovidebodysubstancesamples(suchasurineand/orblood)todeterminetheillicitorillegaluseofdrugsandalcoholatanytimeduringtheiremploymentifthereisjustifiablecausetodoso.Allemployeesaresubjecttopostaccidentdrugtesting.Anemployeeinvolvedinawork-relatedinjuryisrequiredtotakeadrug/alcoholtestwiththeirpost-accidentvisitatanycareprovider.SFM'sDrug-FreeWorkplacePolicysendsaclearmessagethatalcoholanddruguseintheworkplaceisprohibited.Objectives/Goals>Toreducedruguseintheworkplace>Toincreaseproductivity>Toimproveefficiency>Toreduceaccidentsintheworkplace>Todeliverbettercustomerservice>Todemonstrateamoreprofessionalattitudeandstandardofconduct>Encourageemployeeswhohavealcoholand/orsubstanceabuseproblemstovoluntarilyseekhelpToachievethesegoals,SFMServicesconducts:>Initialandperiodicsafetytrainingsessions>DrugAbuseAwarenesspamphlets>RandomDrugScreeningofexistingemployees>AlcoholandDrugscreeningintheeventofwork-relatedaccidents>CompletedrugScreeningofalljobcandidatespriortostartofassignments>Formalandinformalcounselingbytrainedsupervisors(IISFM^111JanitorialPa^1^Wl26 EMPLOYEEIDENTIFICATION&UNIFORMSWerealizetheimportancethataproperlyidentifiedemployeecanhaveworkinginagovernmentbuildingandpublicspaces.Forthisreason,SFMprovidesuniformsthatareeasilyidentifiableandprofessional.Janitorialemployeeswearorange-coloredt-shirtswithourlogoclearlyvisibleonbothsides.Thiscolormakesidentificationeveneasier.Shirtsaremadeofapolyester-cottonblendthatmakesiteasyforourcleaningstafftokeepthemclean.Weissuethreesetstoeachemployeeandmendorreplacethemasneeded.Shouldyouwishadifferenttypeofuniform,wecanprovideshirts,slacks,windbreakers,andparkas,alllabeledwiththeSFMlogo.Byrequest,wecanprovideuniformstailoredtorepresentyou,matchingcolors,andlogos.Theidentificationcardisjustasimportantasaclearidentifiableuniform.EverySFMemployeeisprovidedanemployeeIDandrequiredtocarryitwiththemduringworkhours.SFMunderstandsandenforcestheneedtohaveallpersonnelclearlyidentified.Wewanttomakesureyourpatients,hospitalstaff,andvisitorsfeelsafeandthattheyalwaysknowwhoisworkingaroundthem.ElsaMarreroJanitorial00000(IISFM”11JanitorialPa^1«fe1<§|8l26 UKGTIMEANDATTENDANCESYSTEMBelowisalistoftailoredservicesavailablethroughoursoftware.BiometricFingerprintEquippedTimeClocksMobileTimeTrackingAppTelephoneTimeTrackingRealTimeAlertsInworksiteswhereatraditionaltimeclockisnotanoption,SFMServicesallowstelephonetimetracking.Inanutshell,telephonetimetrackingallowsemployeestoclockinandoutviaalandline.Employeessimplycallatoll-freenumberandfollowtheprompts.Thesepunchesareauditedregularly,toensureemployeesarepunchingintotheassignedlandline.SFMServicesusesbiometrictimeclockstomaketimefraudobsolete.Workingintandemwithourcloud-basedtimeandattendancesystem,thebiometricfingerprinttimeclocksystemsgiveusrealtimevisibilityintoourworkforce.Real-timealertsaredesignedtoensurethatouremployeesareintheirdesignatedworksitesontime.Ateamofpersonnel,includingtheSupervisorandManager,receiverealtimealertswhenascheduledemployeeforgetstopunchin,punchesinlate,orfailstoreporttowork.Thisschedulingtechnologyassistsusinrespondingimmediatelytonoshows.SFMServicesofferstheon-the-goemployeestheoptiontoclockin/outviaamobiletimeclockapp.TheappcontainsGeo-fencingandGeo-tracking,sothatwecansecurelytrackourworkforce.MobilePunchcapturesthedate,time,andGPSlocationofeachpunch.InadditiontoUKGUltiPro,we'veintegratedUKG'sWorkforceReadyManagementsoftwaretomonitorandcontrolallaspectsofemployeetimeandattendancewhilereducingthecostofovertime,administrativelabor,andclericalmistakes.Notonlydoesthisintegrationallowustoeffectivelymanageourremoteteams,italsoensureswehavetheadequatestaffavailabletocarryoutthedailyoperationaltasksassignedtoeachlocation.SFMhasimplementedUKGUltiProasitsHumanResourcesInformation•ASystem(HRIS)includingbutnotlimitedtorecruiting,onboarding(whichAfacilitatesnew-hirecompliancesuchas1-9management,E-Verify,W-4Jfilingandnew-hiringmandatedtraining),employeedatamanagement,timeandattendance,payrollprocessingandtaxcompliance,certificationanddevelopmenttracking,documentretention(includingconfidentialdocumentmanagement),COVID-19VaccineDocumentManagement,scheduling,benefitcomplianceandadministration,grievanceandperformancemanagementforaccountability,customreportingandbusinessintelligence,andoffboarding.<|ismWilJanitorialPa^1^1^126 10.SAFETYANDTRAININGPROGRAMOurTeampridesitselfinhavingoneofthebesttrainingprogramsinthejanitorialsector.Thequalityofservicewedeliverthroughextensivetraininghaspermitted**ustogrowexponentiallyoverthelastdecade.Webelievethatthebestwaytoofferexceptionalservicetoourclientsistorecruitthemosttalented,dedicatedpeopleintheindustry.Wethentrainthemtomeetourhighstandardsandmakecertaintheyunderstandthatnothingstandsinthewayofcustomersatisfaction.ThetrainingisconductedbySFM'sRiskandSafetyManager,LuisSanchez.Mr.SanchezisanOSHA501certifiedinstructorwiththeStateofFlorida.ThisisacompetitiveadvantageSFMhasoverotherjanitorialcompanies.ItgivesSFMtheabilitytotrainandretrainemployeesasnecessarythroughouttheyear.Ourprogramconsistsofextensiveclassroomandhandsontrainingprocedures.ThefollowingmethodologyisemployedbyLuisSanchezforhistrainings:1.Classroomteachingisbasedonresearchandpersonalexperiences.2.Professionalparticipationbyexpertsinthefieldofthesubject.3.Practicalexercisesdiscussedandactedinroleplaysinclass.4.SituationalExerciseswherespecificissuesarepresentedandresolvedinclassbythestudentandfurtherdiscussedinagroupsetting.5.TestingandQuizzesofmaterialssharedinclass.6.Providingtrainingmaterialswhennecessaryforfurtherevaluationandstudy.(IISFMIIJanitorial TRAININGCERTIFICATIONSTHEUNIVERSITYOFALABAMAOSHATRAININGINSTITUTEEDUCATIONCENTERCertifiesthatLuisG.SanchezHasattendedandsuccessfullycompletedtheOSHA501TrainerCourseinGeneralIndustryHeld11/28/2022-12/1/2022inMobile,ALUnderthesponsorshipoftheOSHATrainingInstitute,toobtainthisCertificateofCompletionff2211-SHO5O1-O9-1128ContactHours2.8ContinuingEducationUnits(CEUs)earnedYourTrainerStatusExpires:12/1/2026Robert.4OSHASherylOSHAT/ahiuaLsf^rattfOwesTh*LsivenitjuiAkd^saaTATrainingInstituteMrJllAEducationCenters*TheUniversityofAlabamaPa^1«fc1<5Pl26fllSFMWIIJanitorial INCCERTIFICATEOFCOMPLETIONTERMINALCLEANINGHi'scntcxltoPascaleLopezAimia.PrecautionsHvjnJMaDisposalofWasteRod)FluidsISlOalnr.L-KUitsPervxulProtectivePquinrcriHardwashingTechniqueslixponucIncidentReportingremindCfcutngQiaahtyCortrol•(ontaminaiionAContagiousdiseases•RIwJIx<tkPathogcr,•Termirj)Cleaning-PrcxluttstorlennirulCleaning•TcmurjlCleaningContentsreducesoarRisk•OSHARegulation,Th»»couneincludesthefollouiagobjrcfnnnod1»consbtenIwithOSHABoodbornePathatcnsManiardJK'mHlaHIM//a.on«<uiiipk’tcJ'Rniuiu!Ckiinii^'1ixuimt<i.iumienimi/iOSHAJilt*tlbtuni'I'.njKi^vn^SLuuldJtli'jmTIiI'Jlo.ltl.liiSCRVICCS,(NC.CERTIFICATEOFCOMPLETIONTERMINALCLEANINGEileenDominguezmthis\|KdJuu-piiR.Puum(crtijici/inttriHluSlMtnJHnitkliIhiecourseioeladcsthefolloninjobjectivesandiscoascUentwithOSHhBaodhnrucPathogen*Standard29(FR1910.1030-Comami-MiioaAContagiousdiseases-BloodbornePathogen,-TerminalCleaning•Product,TurTcrmru!Cleaning-IcrmirulCleaningConcerns•HowtoreduceyourRiskJ6HARegulationsPrecautionsHa/ardsusDisposalofWaste•BodyFluidsascontainruntsPersonalPiutcvtiscEquipment1landwishingTechniquesIncidentRcpcrtrngterminalCleaningQua!itsControlmitcidwlhtxinipKtedKiimml(L-Jiim^11muni,।mth()SI1.1lilthulhnnulttduK;cn»Sunthuh(HiI'HOlO.'lftluirln.rritiGliedihrrandnhlrrunner!iqdrtpllitetriunea,prewiltedOSHAMaraHernandezUniscrMlPrcejulonsIiazarduusDisposalufWasteBodyFturdsascontaminant,PciMtrulPhrtcxincEquipmentHandwashingTechniquesIncidentReportingResponsibilities•HowBlmxllwiePathogensarcspread•HepatitisBV.tusHcpitiasCVru*•SkinDiseases-HowtoreduceyourRisk•CDCSutwtissBloodbornepathogensCERTIFICATEOFCOMPLETIONIhiscisuneiadudesthefonitwinsobjcctismandiscooshtentwithOSHAHoudbomcPathogensSUadard29CFR1910.1(130ILtxfthtt\dtiBituiniikk-dlilm>dlh»ntePmIiuklii*lituittn/{n>ii!ii\icMmthOSH1Hi.hdlh.nu-IMw-u.SputnikHHO.IHiO1Iwirln.irilifstintdr<Ai«!i!iitIlUikJuiUu,i\ibfkjl>tn>KUiJ^loidsfimpktcddieU?rnngiiprcriaedBLOODBORNEPATHOGENSOSHAetoorjtemeiW>o9c<wCERTIFICATEOFCOMPLETIONPresentedtoCaridadLopezH,i.iittiv.-diifhIll.'ii.xllmthTmtiuut:.u>nn'iOSH1Hhitdltiuiu-PmIhi^iuSUnthnhHiI'H"I’■'•AThiscourseincludtithefallowlagobjectivesendisconsisttatwithOSH\BocdbomrPstbocrmSundurd29CFR1910.1030Hlx-dhomePathogensareipr^lepuiii,HVirusHcpililisCVirusHikandAxls•SkinDivasea(oped*eyoutRiskCDCSttts'«s-InivcrulPnxautijnsDiqxisalitUasitBodyHuiitscontiminants-Peruim]rrotectisehqaipncniHandwashingTechniques•kxposucIncidentRcpcntgImployerRc^vnaibhuesPa^S6l«fe'k^|B126IISFM11Janitorial rse.NOVEMBER2023kVOHUlKJfnanuirciRAtniUMHM>(MaUMM.EXCELLENCEPoweredByThisgraduateha*passedtheMasterGreenTechnicianGouDAVIDTHOMPSONDinctorAcademyofCtccmmg'BOBBYZAGERSI.C.E.GEMSupplyCompanyasinstructedbytheAcademyofCleaningExcellence.ThiscertifiedMasterTechniciannowhn*theknowledgiandconceptualabilitytoapplyhealthy.Bc*tPractices,withinconmipreialenvironment'-.CERTIFICATEOfCompletionForCertificateofAchievementPresentedto:PascaleLopezhuereceived0.2CEL'forsuccessfullycompletingBestPracticesforElectrostaticandOtherSprayerTechnologyRoundtableTestname)2720BestPracticesforElectrostaticandOtherSprayerTechnologyRoundtableScore100°o55TradePreuSfeJtatirvapIniTbuHthJanW’lPascaleLopez•tarttyCERT1F60n««080.1ISSACManogInduttyfanngSandedADVANCEDPROFESSIONALIN12GeneralSafetyWWA-W.n»cMrWISSAVMMGCIGreenMasterTechniciangCITS•**OPascaleLopez•M'.OyCERHFEO»>anolfaMISSACfanrgnlatryTr.rangSta-ioardADVANCEDPROFESSONALIM16HazargCommuixahonGCIGreenMasterTechnicianT>*ic«rtfca»crar»MatofimuJTy1820IfoparedofIS^AgCITSaCERTIFIEDuanoRoUISSACManrgaiOirttryfaringSUndan)ADVANCEDPROFESSIONALIN15RestroomCareMWUrg**<MoMISSAV.W.4Pngtr.GCIGreenMasterTechnicianTWfdfh^im«MofJMy172017fo«apareddOHywaISSAPa^1^Wl26<I|SFMIIJanitorial OcnyMlrKlSafetywlIlnltbAdrJnJstrMfcan20-900557980Thucardadtnotricdgcs(hattherecipienthisnicrcEsfullyc<wTplete±30-hourGeneralIndustrySafetyandHealthThiscardissuedtoAlejandroDiColaDavidECouchJrTrainerName9/30/2023DaleIssuedJiaAxaXn.FLORIDAINTERNATIONAL*WUNIVERSITYyhiurTitfm(rrufiijteofl\trtkipjtKmtoACejandro(DiColaforparttciiKittngtnaIlirftjimnjinInfectious(Diseasesinthe'Workplace(includingCOW®19)SeplcmitrI-t.202J<||SFMWIIJanitorialPa^l^1<^126 CleanCheckTRAININGSYSTEMPedroReus_hascompletedtheC'eanCheckmodulelotClassroomCleaninghasprovendedicatedtoprofessionalismmhis/herwork;hasdemonstratedoutstandingproductknowledgeandsafetyprecautions:andhasmasteredthedetailsofClassroomCleaning.BeitherebysncwnthatSPARTANCHEMICALCOMPANY,INC.proudlycedif.esPedroReusasaCleanCheckProfessionalofC4H«potCHkawp.iCIeanCheckTRAININGSYSTEMPedroReushascompletedtheCleanCheckmoduleforHardFloorCarenasp<c-/endedicatedtoprolessooalsminhis/herwork;hasdemonstra'edoutstandingproductknowledgeandsafetyprecautions:andhasmasteredthedclaIsolHandFloorCara.BeitheresyknownthatSPARTANCHEMICALCOMPANY.INC.proudlycertifiesPedro..ReusasaCleanCheckProfessionalofHardFinerCam(CleanCheck*TRAININGSYSTEMPedroReushascompletedtheCleanCheckmoduleforFitnessFaclitlrwhasprovendedicatedtoprofesswaiismmhtyherwk,hasdemonstratedoutstandingproductknowledgeandsafelyprecaulonsandnasmasteredthedetailsofFrtaessEaciLaesBeitherebyknownthatSPARTANCHEMICALCOMPANY.INC.proudtycertif.esPedroReusasaCleanCheckProfessionalofFitnessFacilitiesJ/24/2019t»*cPedroReusasaCleanCheckProfessionalotKitchenSandatcr1/24/2019TRAININGSYSTEMBeitnereby«i»ntnatSPARTANCHEMICALCOMPANY,INC.proud.’rcertifiesPedroReush*scompletedtheCleanCheckmoduleforK.JchenSanitationhaspoerdedicatedtoprofessionalismmbrs/wwc-k.hasden-xmstrj'edoutstandingprocuctknowledgeardsafetyprecautwns,axlhasmasteredthedetaIsofKitchenSantalor[CleanCheck*(CleanCheck*TRAININGSYSTEMPedroReushascompletedth-CleanCheckmoduleforCarpetCarehasprovendedicatedtoprofessionalisminhis/herwork,hasdemonstratedoutstandingproductHowledgeardsafetyprecautionsandhasmasteredtledetailsofCp'wtCareBeitherebyknownthatSPARTANCHEMICALCOMPANY.INC.prouchycertilesPedra.Reusa*aCleanChe'kProfessionalofCarpalCare1/23/2019Srl.Pa^l^1<f|8i26«||SFMIIJanitorial 11.QUALITYASSURANCEPLANAmajorkeytooursuccessistheimplementationofourweb-basedqualitycontrolprogramOrangeQC.OrangeQCallowsustodeliverreal-timeconsistentreportsonhowwellwe'reservingyou.You'llseetheinspectionscoresforyourfacilities,aswellasourresponsetimesforyourworkordersandincidentreports.SFM'sQCsoftwarewillguaranteeallservicesallservicesareperformedtothehigheststandardasrecognizedbycustomandusageintheindustry.Enclosedwedescribesomeofourmethodsregardinginspectionprogramsthatinvolvefirstlineemployees,supervisors,andthemanagementteam.Allareinvolvedinqualitycontrolandallaretrainedtounderstandtheirroleinthisproject.WealsohaveQualityControlManagersthatareinvolvedinallSFM'saccounts.OurQualityControlManagerswillbeveryactiveinthisaccountaswemoveforward.Otherthansafety,providingthebestpossibleservicetoourcustomersisparamount.Andthatcanonlybeachievedbymaintainingexcellentqualitystandards.Wehaveanin-houseprogrammingteamthatwillcustomizeprogramsthatreflectthespecificneedsandrequirementsofyourfacility.Wewillworkwithyoutodevelopareportinaformatthatfitsyourneeds.Thefrequencyofinspectionsisdeterminedbasedonfixedorrovingassignmentswhichcanrangefrommonthlytoquarterly.Someofthebenefitsfromthisinspectionprogramaredetailedwithinthissection.Withtheseimprovedcontrols,ourTeamcantrackworkperformanceandhighlightopportunitiestoenhancetheoverallappearanceofyourfacilitieswhilekeepingourteammembersengagedintheoperation.Thewrittenwordreallydoesthesystemlittlejustice.Itmustbeexperiencedtotrulybeappreciated.Ourqualitycontrolprogramdeliverscustomersatisfaction.ProgramObjectives:•Ensurethatallemployeeshavetheknowledgeandskillsneededtoperformtheirjob.•Developnewskillsincurrentemployeestoenablethemtoabsorbchangesintechnology.•Improvetheproductivityofbothindividualsandworkteams.•Encourageemployeeself-developmentandinvolvementinprogramsoflifelonglearning.ThissoftwareallowstheSFMQualitycontrolofficersto:•Performinspectionusingasmartphoneortablet.•Monitorsaccountperformance&sendsrealtimealertsbasedontriggersyouset.•Generatereportsforcustomers.TheSFMQualityControlProgramconsistsoftwomutuallysupportingmodules:1.QualityControlPlan-establishstandards,supportingprocesses,performanceobjectivesandperformanceindicatorstomeetallperformancerequirements.2.QualityControlMonitoringPlan-implementSFMQCtoprovideastructuredapproachtoperformancemonitoring,deficiencyavoidance,correctiveactions,andreporting.(IISFM^11JanitorialPa^iqfc1<§Pl26 CLIENTTICKETSYSTEMIt'sassimpleas1-2-3!Sendemailtoticket@sfmservice(IISFMWIIJanitorialRECEIVESANALERTCLIENTTICKETSYSTEMRESOLUTIONTicketisaddressedandclosedoutThisticketwillremaininyourQCfileandusedforanalytics.ThroughourQualityControlsoftware,weaskourclientstousethe"TicketSystem".Thisfeaturehelpsusdocumentandkeeptrackofthequalityofourservices.OPENATICKETTicketissenttoOperationsTeamSFM'sExecutiveLeadershipTeamCOO,&President)Pa^l!<lfiW126 1.TICKETCREATEDBYCITYOFMIAMIBEACHFrom:Delgado,Steve<SteveDelgado@miamibeachfl.gov>Sent:Thursday,December21,20237:10:31PMTo:Ticket<ticket@sfmservices.com>;CLIENTTICKETSubject:G-9(1661PennsylvaniaAve)Goodevening,Attheabovelocationstair#1level6(SWcorner)outsideelevatorthereisfecescanwehavesomeonetakecareofthismatter.Seeattachpicture.Thankyou.SteveDelgado,ParkingOperationsSupervisor(Off-streetUnit)2.TICKETACKNOWLEDGEDBYSFMWITHIN9MINUTESFrom:PedroReus<preus@sfmservices.com>Sent:Thursday,December21,20237:19:33PMTo:Delgado,Steve<SteveDelgado@miamibeachfl.govSubject:Re:G-9(1661PennsylvaniaAve)GoodeveningSteve,I'msendingthecrewrightnow.Regards.PedroP.Reus3.TICKETCLOSEDWITHINTHEHOURFrom:PedroReus<preus(5)sfmservices.com>Date:December21,2023at8:14:51PMESTTo;"Delgado,Steve"<SteveDelgado(a)miamibeachfl.gov>Subject:Re:G-9(1661PennsylvaniaAveJGoodeveningSteve,Allcleanedanddone.Homelessmanwhodiditwasstillherechangingclothes.(IISFM^11JanitorialPa^iq61<5|Bl26 MEASUREMENTTOOLSEmailnotificationsareconfiguredtonotifySFMmanagersabouttheQCperformance.TheQCofficer'siPadautomaticallysynchronizesviaawirelessnetworkconnection,soQCinspectionscanbetrackedinreal-time.Correctiveactionrequestsareimmediatelycommunicatedtotherelevantperson.Allqualitycontrolinspectionshaveprecisetimestampstoensurefrequencyofmonitoringandaclearindicationofthedate,time,area,andresultsofthemonitoringprocess.CLIENTANALYTICSBelowisreportprovidedtoclientthatwillshowtheevaluationofprogressin3formswhichinclude:GraphshowingcomparinghistoryPieChartThesereportscanbeemailedtopropertymanagersinapdfformat.Managementreportscontainthefollowing:>Laborbudget>Suppliesbudget>Equipmentbudget>SalesSfMServices>cityofsouthMiamifllSFMWIIJanitorialPa^43iq61^Bl26 SFM’SINTERNALCOMMUNICATIONSYSTEMInordertomaintainhighqualitystandards,SFMreliesoneffectiveinternalcommunicationtoquicklyremedyanyaccountdeficiency.BelowisarepresentationofSFM'sinternalcommunicationprocesswhenanareaisfounddeficientbyaqualitycontrolofficer.Whileconductingsiteinspections,SFM'sQ.C.Officergivesabelowaveragegradeactivatinga"RealTimeAlert"Oncethedeficiencyisremedied,theAreaSupervisorwilsendaconfirmationemailclosingouttheinternalticket.AreaSupervisorandSiteSupervisorwillcoordinatewithStafftoaddressthedeficiencywithin24hrs.TheRealTimeAlertissentviaemailtotheProjectManager,AreaSupervisor,Director&President.TheAlertwillidenifythedeficiencyasshownonoursampleinspectionreports.Thisemailwillremainactiveuntilaconfirmationemailissent.(IISFM^11JanitorialPa^WtlWl26 INSPECTIONREPORTS#9467608BATHROOMSLocation:Inspector:Completed:2023-00-213:42pmScore:100%LineItemLocation1Toilets2FloorsBaseboardsUrinalsPartitionsRatingExcellentExcellentExcellentExcellentExcellent<||SFM11Services,Inc.Score100%100%100%100%100%(||SFMWilJonitonal26 LineItemSinks95Mirrors6VentsTrash7DoorsShowersNotesWaterFountain8RatingExcellentScore100%Excellent100%ExcellentExcellent100%100%ExcellentExcellentExcellent100%100%100%Pa^6iqfe1<§|Bl26^111Janitorial #9467608PhotoAppendixfllSFM^||Services,Inc.4ln-appPhoto2023-06-273:40pm7InappPhoto2023-06-273:41pm2ln-appPhoto2023-06-273:40pm5ln-appPhoto2023-06-273:40pm8ln-appPhoto2023-06-273:42pm3InappPhoto202306-273:40pm6ln-appPhoto2023-06-273:40pmflSFM11JonitorielPa<H7iql7l<f0126 OverallReportshowingaverageinspectionScore,numberofinspections,flaggedinspections,deficientinspections,anddeficientlineitems.OverallReportDec8,2024-Jan22,2025Reports/Overall/CITYOFMIAMIBEACHAverageInspecoonScore99.35%Avg.InspectionScoreInspections115FlaggedInspections8Deficientinspections08•DeficientLineItemsO8InspectionsPerformed000000<||SFMWilJanitorial 12.DISTINCTIVESERVICESOFFEREDSFMprovidesadditionalyear-roundservicesincludingbutnotlimitedtoparkinglotandstreetsweepingservices,pressurecleaningservices,andlittercontrolservices.SFMhasafleetof(7)streetsweepersusedtocleanmunicipalstreets,highways,andparkinglots.DebrisRemovalAvailableEventCleaningAvailableTrailermountedpressurewashingrigsequippedwithwaterholdingtank&steampressurecapability.Self-loadergrappledumptrucks(upto100CY)Echo-friendlyvehiclesforlittercontrol.SFMisequippedtocleanuplargescalepublicevents.2017UltraMusicFestpicturedabove-165,000inattendance.26(IISFM”11Janitorial EVENTCLEANINGSFMcanbeavaluableassetforlargeoutdoorevents.Withextensiveexperienceineventvenuemaintenance,SFMhasbeenatrustedpartnerformanylarge-scaleevents.OnenotableexampleisattheOrangeBowlStadium,whereSFMprovidedeventcleaningfrom1972to2007.SFM'sexpertiseinhandlinglargeeventsandcommitmenttocleanlinessandprofessionalismmakesustheidealpartnerforanyoutdooreventorganizer.Othereventvenuescurrentlyservicedare:>DadeCountyFair&Expo.Center>Ultra-MusicFestival>BayfrontPark&Amphitheater>2010SuperBowl&ProBowl>MercedesCorporateRunYearsServiced:1972to2007Miami-DadeCountyFair&Exposition,Inc.YearsServiced:1978toPresentUltra-MusicFestival165,000Attendancein3-daysYearsServiced:1998toPresent(IISFMIMonitorial DISASTERRECOVERYSERVICESSFMServicesisoneofSouthFlorida'stopdisasterrecoveryserviceprovider.PostHurricaneIrma,SFMremovedoverone(1)millioncubicyardsofdebristhroughoutMiami-DadeCounty.SFMhasthenecessaryresourcesandexperiencetoprovidecompletedisasterrecoveryservicesTherefore,foranyemergency,SFMispreparedtodeployandfacilitatequicklyandefficiently.Someofourclientsindisasterrecoveryservicesinclude:>Miami-DadeCounty>Miami-DadeCountySchoolBoard>FloridaDept,ofTransportation>CityofCoralGables>CityofDoral>TownofMiamiLakes>VillageofPinecrest>CityofNorthMiamiBeach>VillageofMiamiShores>CityofWestPark>BaptistHealthSouthFloridaSFMhasprovideddisasterrecoveryservicetoseveralmunicipalitiesafterthefollowingstorms:T1992HurricaneAndrewT2004HurricaneFrancisT2004HurricaneCharleyT2005HurricaneKatrina(Mississippi&Florida)T2005HurricaneWilma(Mississippi&Florida)T2005HurricaneDennisT2008HurricaneIke(Texas)T2017HurricaneIrma(IISFM^lllJanitoriolPai§119<i1<fPl26 HIGHDISINFECTIONSERVICESSFMcanhelpmitigatethespreadofinfectionincludingCOVID-19byprovidingHighDisinfectionCleaningandElectrostaticDisinfectionServices.SFMonlyuseshospitalgradeandEPAregisteredproductsthatkill99.9%ofbacteriaandvirusesincludingCOVID-19.Akeyadvantagetothehighlyaffectiveelectrostatictechnologyisitsabilitytocover100%disinfectantsolutiontotheappliedsurfaces.SFMisoneoffewlocalcompaniesproviding"ElectrostaticDisinfecting"whilemostcompaniesareusingalesseffectivemethodcalledfogging.SFMcurrentlyofferstwodifferentmethodsofdisinfectionservices:1.ElectrostaticDisinfection.UsingonlyEPAregistereddisinfectants,ElectrostaticDisinfectionprovides100%coverage.2.ManualDisinfecting.CompleteHigh-Disinfectionwipedownofallhigh-touch,verticalandhorizontalsurfaces.(Tables,desktopequipment,lightswitches,doors,doorknobsetc.)OneofthefirstCOVID-19casesinMiami-DadeCountywasintheTownofBayHarborIslands.SFMwascontractedtoprovidehighdisinfectioncleaning.OtherclientswehavehelpedwithCOVID-19casesinclude:•Miami-DadeCountyParks-Dailydisinfectionof75parks.•Miami-DadeCountyEmergencyCOVID-19Clean-Up,RestorationandDecontaminationServicestoRedRoof&HamptonInnhotels.•Miami-DadeCountyPublicSchools(The1stschooldisinfectedintheCounty).•CityofCoralGablesPoliceDepartment.•CityofHialeahCityHall&FireStations.•CityofMiamiBeachCityHall,Cityfleet,&facilities.•TownofBayHarborIslandsandmanymore.Afterourdisinfectionservices,weprovideyouwithaCertificateofDisinfection.ThisPromotesasafe&cleanenvironment.Pa^1^1<§Pl26 COMMUNITYINVOLVEMENTSFMstronglybelievesingivingbacktothecommunity.SFMLeadershipisinvolvedinseveralofthecommunitynon-profitshighlightedbelow.CityofMiamiBeachCleanUpSFMhelpedcollect4,125lbs.oftrashupalongtheJuliaTuttleCausewayChristianInfanteservesasBoardDirectorforMiamiLighthousefortheBlindipMiaminLighthouseA^BLINDandVisuallyimrmred<||SFM^11JanitorialPa^1C61^8l26 ThankYouforYourServiceAsathankyoutoour1stResponders,SFMsenttraineddisinfectingcrewstocleananddisinfecttheinteriorofpolicefleetsatnochargetoseverallocalpolicedepartments.SFMDonatedFaceBuffstoGablesPoliceDepartmentSFMdonated300customfacebuffsfortheCityofCoralGablesPoliceDepartmentwiththeCGPDlogoprintedonthem.(IISFM^■11Janitorial EveryWednesdayfor6monthsduringtheCOVIDpandemicwasPizzaDayforthefosterchildrenandstaffatHisHouseChildren'sHomecourtesyofSFMandtheirpartnersatPowerPizza.HisHOUSECHILDREN'SHOMEWesupport"RedNoseDay".FundsraisedbenefitchildreninsomeofthepoorestLaLigaContraElCancerWalkSFMsupportsannualbacktoschoolMiamiDadeSchools&MiamiDolphinsButterflyGardenSFMparticipatesintheannualSusanGKomen#RaceForTheCureCityofDoralEarthDayTreeDonationPa^§512feWl26fllSFMWilJanitorial Pa^l<2fcW1264SFMJanitorial EXHIBIT“C”RATESCHEDULECityofSouthMiami157of158Exhibit“C” Wednesday,April30,2025JohnReeseCityofSouthMiami6130SunsetDr.Miami,FL.33143DearMr.Reese:PursuanttoyourrequestandRFP2024-17JanitorialServicesforCityofSouthMiami,belowpleasefindextendedamountsbasedonthereducedscopeofworkrequestedbytheCityCommission.Thebelowareforthefollowinglocations:1.SylvaMartinandPorch;CityHall;PoliceDepartment2.PublicWorks3.DanteFascellParkYearAnnualYear1$54,020.72Year2$57,802.17Year3$61,848.32Year4$66,177.70Year5$70,810.14WelookforwardtoworkingwiththeCity.Thankyoufortheopportunitytobeofservice.Feelfreetocontactmedirectlyifyouhaveanyquestionsat305.525.9442.Respectfullysubmitted,ChristianInfantePresident7500NW74*Ave.Medley,FL.33166Ph:305.818.2424Fax:305.818.3510 PROFESSIONALSERVICESAGREEMENTBETWEENTHECITYOFSOUTHMIAMIANDFLORIDAPREFERREDGROUP,LLCTHISAGREEMENT(this“Agreement”)ismadeeffectiveasofthe1dayofMAY,2025(the“EffectiveDate”),byandbetweentheCITYOFSOUTHMIAMI,aFloridamunicipalcorporation,(hereinafterthe“City”),andFLORIDAPREFERREDGROUP,LLC,aFloridalimitedliabilitycompany(hereinafter,the“Consultant”).WHEREAS,theCityrequiresjanitorialservicesatvariouslocationswithintheCity(the“Services”),assetforthingreaterdetailintheScopeofServicesattachedheretoasExhibit“A”;andWHEREAS,onDecember18,2025,theCityissuedRequestforProposalsNo.FN2024-17(the“RFP”)fortheServices,whichRFPisincorporatedbythisreferenceasiffullysetforthherein;andWHEREAS,theConsultantsubmittedaProposalinresponsetotheRFP,whichProposalisattachedheretoasExhibit“B”;andWHEREAS,onMarch18,2025,theCityCommissionadoptedResolutionNo.017-25-16309,approvingtheawardofthisAgreementtotheConsultantfortheprovisionoftheServicesattheCommunityCenter,theBasketballCourts,theMarhsallWilliamsonBuilding(akaMobleyBuilding),andtheSeniorCitizensCenter(collectively,the“Locations”)inanamountnottoexceed$235,524.90overthethree-yeartermandthetwoadditionalone-yearrenewaloptionyearspursuanttotheRFP;andWHEREAS,theConsultantandCity,throughmutualnegotiation,haveagreeduponaRateSchedulefortheServicesattheLocations,whichRateScheduleisattachedheretoasExhibit“C”;andWHEREAS,theCitydesirestoengagetheConsultanttoperformtheServicesandprovidethedeliverablesasspecifiedbelow.NOW,THEREFORE,inconsiderationofthemutualcovenantsandconditionscontainedherein,theConsultantandtheCityagreeasfollows:1.ScopeofServices.1.1.ConsultantshallprovidetheServicesattheLocations,assetforthingreaterdetailintheRFP,theScopeofServicesattachedheretoasExhibit“A,”andtheProposallot87 attachedheretoasExhibit“B”andincorporatedhereinbyreference(the“Services”).12.Consultantshallfurnishallreports,documents,andinformationobtainedpursuanttothisAgreement,andrecommendationsduringthetermofthisAgreement(hereinafter“Deliverables”)totheCity.2.Term/CommencemcntDate.2.1.ThetermofthisAgreementshallbefromtheEffectiveDatethroughthree(3)yearsthereafter,unlessearlierterminatedinaccordancewithParagraph8.Additionally,theCityManagermayrenewthisAgreementfortwo(2)additionalone-yearperiodsonthesametermsassetforthhereinuponwrittennoticetotheConsultantforatotaltermoffive(5)consecutiveyears.22.ConsultantagreesthattimeisoftheessenceandConsultantshallcompletetheServiceswithinthetermofthisAgreement,unlessextendedbytheCityManager.3.CompensationandPayment.3.1.CompensationforServicesprovidedbyConsultantshallbeinaccordancewiththeRateScheduleattachedheretoasExhibit“C”inanamountnottoexceed$235,524.90overthethree-yeartermandthetwoadditionalone-yearrenewaloptionyears.CompensationfortheprovisionoftheServicesattheLocationsshallbeasfollows:3.1.1.YearOne:$3,556.87permonth,foranannualtotalnottoexceed$42,682.50;3.1.2.YearTwo:$3,734.71permonth,foranannualtotalnottoexceed$44,816.63;3.1.3.YearThree:$3,921.45permonth,foranannualtotalnottoexceed$47,057.46;3.1.4.YearFour(OptionYear):$4,117.52permonth,foranannualtotalnottoexceed$49,410.33;and3.1.5.YearFive(OptionYear):$4,323.40permonth,foranannualtotalnottoexceed$51,880.84.32.ConsultantshalldeliveraninvoicetoCitynomoreoftenthanoncepermonthdetailingServicescompletedandtheamountduetoConsultantunderthisAgreement.Feesshallbepaidinarrearseachmonth,pursuanttoConsultant’sinvoice,whichshallbebaseduponthepercentageofworkcompletedforeachtaskinvoiced.TheCityshallpaytheConsultantinaccordancewiththeFloridaPromptPaymentActafterapprovalandacceptanceoftheServicesbytheCityManager.4.Subfotuudlants-4.1.TheConsultantshallberesponsibleforallpaymentstoanysubconsultantsandshall 42.ConsultantmayonlyutilizetheservicesofaparticularsubconsultantwiththepriorwrittenapprovaloftheCityManager,whichapprovalmaybegrantedorwithheldintheCityManager’ssoleandabsolutediscretion.5.gjty’sResponsibilities.5.1.Cityshallmakeavailableanymaps,plans,existingstudies,reports,staffandrepresentatives,andotherdatapertinenttotheServicesandinpossessionoftheCity,andprovidecriteriarequestedbyConsultanttoassistConsultantinperformingtheServices.5.2.UponConsultant’srequest,CityshallreasonablycooperateinarrangingaccesstopublicinformationthatmayberequiredforConsultanttoperformtheServices.6.Consultant’sResponsibilities;RepresentationsandWarranties.6.1.TheConsultantshallexercisethesamedegreeofcare,skillanddiligenceintheperformanceoftheServicesasisordinarilyprovidedbyaconsultantundersimilarcircumstances.IfatanytimeduringthetermofthisAgreementorwithintwo(2)yearsfromthecompletionofthisAgreement,itisdeterminedthattheConsultant’sDeliverablesorServicesareincorrect,notproperlyrendered,defective,orfailtoconformtoCityrequests,theConsultantshallatConsultant’ssoleexpense,immediatelycorrectitsDeliverablesorServices.62.TheConsultantherebywarrantsandrepresentsthatatalltimesduringthetermofthisAgreementitshallmaintainingoodstandingallrequiredlicenses,certificationsandpermitsrequiredunderFederal,StateandlocallawsapplicabletoandnecessarytoperformtheServicesforCityasanindependentcontractoroftheCity.Consultantfurtherwarrantsandrepresentsthatithastherequiredknowledge,expertise,andexperiencetoperformtheServicesandcarryoutitsobligationsunderthisAgreementinaprofessionalandfirstclassmanner.63.TheConsultantrepresentsthatisanentityvalidlyexistingandingoodstandingunderthelawsofFlorida,Theexecution,deliveryandperformanceofthisAgreementbyConsultanthavebeendulyauthorized,andthisAgreementisbindingonConsultantandenforceableagainstConsultantinaccordancewithitsterms.Noconsentofanyotherpersonorentitytosuchexecution,deliveryandperformanceisrequired.7..ConflictoHntmst7.1.Toavoidanyconflictofinterestoranyappearancethereof,Consultantshallnot,forthetermofthisAgreement,provideanyconsultingservicestoanyprivatesectorentities(developers,corporations,realestateinvestors,etc.),withanycurrent,orforeseeable,adversarialissuesintheCity.8.Termination.3of87 8.1.Eitherparty,withoutcause,mayterminatethisAgreementuponninety(90)calendardayswrittennoticetotheotherparty.TheCitymayterminatethisAgreementimmediatelywithcause.82.UponreceiptoftheCity'swrittennoticeoftermination,ConsultantshallimmediatelystopworkontheprojectunlessdirectedotherwisebytheCityManager.83.IntheeventofterminationbytheCity,theConsultantshallbepaidforallworkacceptedbytheCityManageruptothedateoftermination,providedthattheConsultanthasfirstcompliedwiththeprovisionsofParagraph8.4.8.4.TheConsultantshalltransferallbooks,records,reports,workingdrafts,documents,maps,anddatapertainingtotheServicesandtheprojecttotheCity,inahardcopyandelectronicformatwithinfourteen(14)daysfromthedateofthewrittennoticeofterminationorthedateofexpirationofthisAgreement.9.Insurance.9.1.ConsultantshallsecureandmaintainthroughoutthedurationofthisagreementinsuranceofsuchtypesandinsuchamountsnotlessthanthosespecifiedbelowassatisfactorytoCity,namingtheCityasanAdditionalInsured,underwrittenbyafirmratedA-XorbetterbyA.M.BestandqualifiedtodobusinessintheStateofFlorida.TheinsurancecoverageshallbeprimaryinsurancewithrespecttotheCity,itsofficials,employees,agents,andvolunteersnamingtheCityasadditionalinsured.AnyinsurancemaintainedbytheCityshallbeinexcessoftheConsultant’sinsuranceandshallnotcontributetotheConsultant’sinsurance.TheinsurancecoveragesshallincludeataminimumtheamountssetforthinthissectionandmaybeincreasedbytheCityasitdeemsnecessaryorprudent.9.1.1.CommercialGeneralLiabilitycoveragewithlimitsofliabilityofnotlessthana$1,000,000perOccurrencecombinedsinglelimitforBodilyInjuryandPropertyDamage.ThisLiabilityInsuranceshallalsoincludeCompletedOperationsandProductLiabilitycoveragesandeliminatetheexclusionwithrespecttopropertyunderthecare,custodyandcontrolofConsultant.TheGeneralAggregateLiabilitylimitandtheProducts/CompletedOperationsLiabilityAggregatelimitshallbeintheamountof$2,000,000each.9.1.2.WorkersCompensationandEmployer’sLiabilityinsurance,toapplyforallemployeesforstatutorylimitsasrequiredbyapplicableStateandFederallaws.Thepolicy(ies)mustincludeEmployer’sLiabilitywithminimumlimitsof$1,000,000.00eachaccident.Noemployee,subcontractororagentoftheConsultantshallbeallowedtoprovideServicespursuanttothisAgreementwhoisnotcoveredbyWorker’sCompensationinsurance.9.1.3.BusinessAutomobileLiabilitywithminimumlimitsof$1,000,000peroccurrence,combinedsinglelimitforBodilyInjuryandPropertyDamage.Coveragemustbe4of87 affordedonaformnomorerestrictivethanthelatesteditionoftheBusinessAutomobileLiabilitypolicy,withoutrestrictiveendorsements,asfiledbytheInsuranceServiceOffice,andmustincludeOwned,Hired,andNon-OwnedVehicles.9.1.4.ProfessionalLiabilityInsuranceinanamountofnotlessthanOneMillionDollars($1,000,000.00)peroccurrence,singlelimit.92.CertificateofInsurance.CertificatesofInsuranceshallbeprovidedtotheCity,reflectingtheCityasanAdditionalInsured(exceptwithrespecttoProfessionalLiabilityInsuranceandWorker’sCompensationInsurance),nolaterthanten(10)daysafterawardofthisAgreementandpriortotheexecutionofthisAgreementbyCityandpriortocommencingServices.Eachcertificateshallincludenolessthan(30)thirty-dayadvancewrittennoticetoCitypriortocancellation,termination,ormaterialalterationofsaidpoliciesorinsurance.TheConsultantshallberesponsibleforassuringthattheinsurancecertificatesrequiredbythisSectionremaininfullforceandeffectforthedurationofthisAgreement,includinganyextensionsorrenewalsthatmaybegrantedbytheCity.TheCertificatesofInsuranceshallnotonlynamethetypesofpolicy(ies)provided,butalsoshallreferspecificallytothisAgreementandshallstatethatsuchinsuranceisasrequiredbythisAgreement.TheCityreservestherighttoinspectandreturnacertifiedcopyofsuchpolicies,uponwrittenrequestbytheCity.IfapolicyisduetoexpirepriortothecompletionoftheServices,renewalCertificatesofInsuranceshallbefurnishedthirty(30)calendardayspriortothedateoftheirpolicyexpiration.Eachpolicycertificateshallbeendorsedwithaprovisionthatnotlessthanthirty(30)calendardays’writtennoticeshallbeprovidedtotheCitybeforeanypolicyorcoverageiscancelledorrestricted.AcceptanceoftheCertificate(s)issubjecttoapprovaloftheCity.93.AdditionalInsured.ExceptwithrespecttoProfessionalLiabilityInsuranceandWorker’sCompensationInsurance,theCityistobespecificallyincludedasanAdditionalInsuredfortheliabilityoftheCityresultingfromServicesperformedbyoronbehalfoftheConsultantinperformanceofthisAgreement.TheConsultant’sinsurance,includingthatapplicabletotheCityasanAdditionalInsured,shallapplyonaprimarybasisandanyotherinsurancemaintainedbytheCityshallbeinexcessofandshallnotcontributetotheConsultant’sinsurance.TheConsultant’sinsuranceshallcontainaseverabilityofinterestprovisionprovidingthat,exceptwithrespecttothetotallimitsofliability,theinsuranceshallapplytoeachInsuredorAdditionalInsured(forapplicablepolicies)inthesamemannerasifseparatepolicieshadbeenissuedtoeach.9.4.Deductibles.Alldeductiblesorself-insuredretentionsmustbedeclaredtoandbereasonablyapprovedbytheCity.TheConsultantshallberesponsibleforthepaymentofanydeductibleorself-insuredretentionsintheeventofanyclaim.95.TheprovisionsofthissectionshallsurviveterminationofthisAgreement.10.Nondiscrimination,DuringthetermofthisAgreement,Consultantshallnotdiscriminateagainstanyofitsemployeesorapplicantsforemploymentbecauseoftheirrace,color,religion,sex,ornationalorigin,andtoabidebyallFederalandStatelawsregarding5of87 nondiscrimination.11.AttorneysFeesandWaiverofJunTrial.11.1.IntheeventofanylitigationarisingoutofthisAgreement,theprevailingpartyshallbeentitledtorecoveritsattorneys’feesandcosts,includingthefeesandexpensesofanyparalegals,lawclerksandlegalassistants,andincludingfeesandexpenseschargedforrepresentationatboththetrialandallappellatelevels.112.INTHEEVENTOFANYLITIGATIONARISINGOUTOFTHISAGREEMENT,EACHPARTYHEREBYKNOWINGLY,IRREVOCABLY,VOLUNTARILYANDINTENTIONALLYWAIVESITSRIGHTTOTRIALBYJURY.12.Indemnification.12.1.ConsultantshallindemnifyandholdharmlesstheCity,itsofficers,agentsandemployees,fromandagainstanyandalldemands,claims,losses,suits,liabilities,causesofaction,judgmentordamages,arisingfromConsultant’sperformanceornon¬performanceofanyprovisionofthisAgreement,including,butnotlimitedto,liabilitiesarisingfromcontractsbetweentheConsultantandthirdpartiesmadepursuanttothisAgreement.ConsultantshallreimbursetheCityforallitsexpensesincludingreasonableattorneys’feesandcostsincurredinandaboutthedefenseofanysuchclaimorinvestigationandforanyjudgmentordamagesarisingfromConsultant’sperformanceornon-performanceofthisAgreement.122.NothinghereinisintendedtoserveasawaiverofsovereignimmunitybytheCitynorshallanythingincludedhereinbeconstruedasconsenttobesuedbythirdpartiesinanymatterarisingoutofthisAgreementoranyothercontract.TheCityissubjecttosection768.28,FloridaStatutes,asmaybeamendedfromtimetotime.123.TheprovisionsofthissectionshallsurviveterminationofthisAgreement.13.Noticcs/AuthoiizedRepresentatives.AnynoticesrequiredbythisAgreementshallbeinwritingandshallbedeemedtohavebeenproperlygiveniftransmittedbyhand-delivery,byregisteredorcertifiedmailwithpostageprepaidreturnreceiptrequested,orbyaprivatepostalservice,addressedtotheparties(ortheirsuccessors)attheaddresseslistedonthesignaturepageofthisAgreementorsuchotheraddressasthepartymayhavedesignatedbypropernotice.14.GoverningLawandVenue.ThisAgreementshallbeconstruedinaccordancewithandgovernedbythelawsoftheStateofFlorida.VenueforanyproceedingsarisingoutofthisAgreementshallbeproperexclusivelyinMiami-DadeCounty,Florida.15.EntireAgreement/Modification/Amendment.15.1.ThiswritingcontainstheentireAgreementofthepartiesandsupersedesanypriororalorwrittenrepresentations.Norepresentationsweremadeorrelieduponbyeitherparty,6of67 otherthanthosethatareexpresslysetforthherein.152.Noagent,employee,orotherrepresentativeofeitherpartyisempoweredtomodifyoramendthetermsofthisAgreement,unlessexecutedwiththesameformalityasthisdocument.16.OwnershipandAccesstoRecordsandAudits.16.1.Consultantacknowledgesthatallinventions,innovations,improvements,developments,methods,designs,analyses,drawings,reports,compiledinformation,andallsimilarorrelatedinformation(whetherpatentableornot)whichrelatetoServicestotheCitywhichareconceived,developedormadebyConsultantduringthetermofthisAgreement(“ServicesProduct”)belongtotheCity.ConsultantshallpromptlydisclosesuchServicesProducttotheCityandperformallactionsreasonablyrequestedbytheCity(whetherduringorafterthetermofthisAgreement)toestablishandconfirmsuchownership(including,withoutlimitation,assignments,powersofattorneyandotherinstruments).162.ConsultantagreestokeepandmaintainpublicrecordsinConsultant’spossessionorcontrolinconnectionwithConsultant’sperformanceunderthisAgreement.TheCityManagerorherdesigneeshall,duringthetermofthisAgreementandforaperiodofthree(3)yearsfromthedateofterminationofthisAgreement,haveaccesstoandtherighttoexamineandauditanyrecordsoftheConsultantinvolvingtransactionsrelatedtothisAgreement.ConsultantadditionallyagreestocomplyspecificallywiththeprovisionsofSection119.0701,FloridaStatutes.Consultantshallensurethatpublicrecordsthatareexemptorconfidentialandexemptfrompublicrecordsdisclosurerequirementsarenotdisclosed,exceptasauthorizedbylaw,forthedurationoftheAgreement,andfollowingcompletionoftheAgreementuntiltherecordsaretransferredtotheCity.163.UponrequestfromtheCity’scustodianofpublicrecords,ConsultantshallprovidetheCitywithacopyoftherequestedrecordsorallowtherecordstobeinspectedorcopiedwithinareasonabletimeatacostthatdoesnotexceedthecostprovidedbyChapter119,FloridaStatutes,orasotherwiseprovidedbylaw.16.4.Unlessotherwiseprovidedbylaw,anyandallrecords,includingbutnotlimitedtoreports,surveys,andotherdataanddocumentsprovidedorcreatedinconnectionwiththisAgreementareandshallremainthepropertyoftheCity.165.UponcompletionofthisAgreementorintheeventofterminationbyeitherparty,anyandallpublicrecordsrelatingtotheAgreementinthepossessionoftheConsultantshallbedeliveredbytheConsultanttotheCityManager,atnocosttotheCity,withinseven(7)days.AllsuchrecordsstoredelectronicallybyConsultantshallbedeliveredtotheCityinaformatthatiscompatiblewiththeCity’sinformationtechnologysystems.OncethepublicrecordshavebeendelivereduponcompletionorterminationofthisAgreement,theConsultantshalldestroyanyandallduplicatepublicrecordsthatare7of87 exemptorconfidentialandexemptfrompublicrecordsdisclosurerequirements.16.6.AnycompensationduetoConsultantshallbewithhelduntilailrecordsarereceivedasprovidedherein.16.7.Consultant’sfailureorrefusaltocomplywiththeprovisionsofthissectionshallresultintheimmediateterminationofthisAgreementbytheCity.16.8.NoticePursuanttoSection119.0701(2)(a),FloridaStatutes.IFTHECONSULTANTHASQUESTIONSREGARDINGTHEAPPLICATIONOFCHAPTER119,FLORIDASTATUTES,TOTHECONSULTANT’SDUTYTOPROVIDEPUBLICRECORDSRELATINGTOTHISAGREEMENT,CONTACTTHECUSTODIANOFPUBLICRECORDS.CustodianofRecords:Nkenga“Nikki”Payne,CMC,FCRMMailingaddress:6130SunsetDriveSouthMiami,FL33143Telephonenumber:305-663-6340Email:NPayne(%southmiamifl.gov17.Nonassignability.ThisAgreementshallnotbeassignablebyConsultantunlesssuchassignmentisfirstapprovedbytheCityManager.TheCityisrelyingupontheapparentqualificationsandexpertiseoftheConsultant,andsuchfirm’sfamiliaritywiththeCity’sarea,circumstancesanddesires.18.Severability.IfanytermorprovisionofthisAgreementshalltoanyextentbeheldinvalidorunenforceable,theremainderofthisAgreementshallnotbeaffectedthereby,andeachremainingtermandprovisionofthisAgreementshallbevalidandbeenforceabletothefullestextentpermittedbylaw.19.IndependentConsultant.TheConsultantanditsemployees,volunteersandagentsshallbeandremainanindependentcontractorandnotanagentoremployeeoftheCitywithrespecttoalloftheactsandservicesperformedbyandunderthetermsofthisAgreement.ThisAgreementshallnotinanywaybeconstruedtocreateapartnership,associationoranyotherkindofjointundertaking,enterpriseorventurebetweentheparties.20.CompliancewithLaws.TheConsultantshallcomplywithallapplicablelaws,ordinances,rules,regulations,andlawfulordersofpublicauthoritiesincarryingoutServicesunderthisAgreement,andinparticularshallobtainallrequiredpermitsfromalljurisdictionalagenciestoperformtheServicesunderthisAgreementatitsownexpense.21.Waiver.ThefailureofeitherpartytothisAgreementtoobjecttoortotakeaffirmativeactionwithrespecttoanyconductoftheotherwhichisinviolationofthetermsofthisAgreementshallnotbeconstruedasawaiveroftheviolationorbreach,orofanyfutureviolation,breachorwrongfulconduct.8of87 22.SurvivalofProvisions.AnytermsorconditionsofeitherthisAgreementthatrequireactsbeyondthedateofthetermoftheAgreement,shallsurviveterminationoftheAgreement,shallremaininfullforceandeffectunlessanduntilthetermsorconditionsarecompletedandshallbefullyenforceablebyeitherparty.23.ProhibitionofContingencyFees.TheConsultantwarrantsthatithasnotemployedorretainedanycompanyorperson,otherthanabonafideemployeeworkingsolelyfortheConsultant,tosolicitorsecurethisAgreement,andthatithasnotpaidoragreedtopayanyperson(s),company,corporation,individualorfirm,otherthanabonafideemployeeworkingsolelyfortheConsultant,anyfee,commission,percentage,gift,oranyotherconsideration,contingentuponorresultingfromtheawardormakingofthisAgreement.24.StateRequiredAffidavits,ByenteringintothisAgreement,theConsultantagreestoreviewandcomplywiththefollowingstateaffidavitrequirements:24.1.PublicEntityCrimesAffidavit.ConsultantshallcomplywithSection287.133,FloridaStatutes(PublicEntityCrimesStatute),notificationofwhichisherebyincorporatedhereinbyreference,includingexecutionofanyrequiredaffidavit.242.ScrutinizedCompanies.ConsultantcertifiesthatitisnotontheScrutinizedCompaniesthatBoycottIsraelListorengagedinaboycottofIsrael.Pursuanttosection287.135,FloridaStatues,theCitymayimmediatelyterminatethisAgreementatitssoleoptioniftheConsultantisfoundtohavesubmittedafalsecertification;oriftheConsultantisplacedontheScrutinizedCompaniesthatBoycottIsraelListorisengagedintheboycottofIsraelduringthetermoftheAgreement.IfthisAgreementisformorethanonemilliondollars,theConsultantcertifiesthatitisalsonotontheScrutinizedCompanieswithActivitiesinSudan,ScrutinizedCompanieswithActivitiesintheIranTerrorismSectorsList,ScrutinizedCompanieswithActivitiesintheIranPetroleumEnergySectorList,orengagedwithbusinessoperationsinCubaorSyriaasidentifiedinSection287.135,FloridaStatutes.PursuanttoSection287.135,FloridaStatutes,theCitymayimmediatelyterminatethisAgreementatitssoleoptioniftheConsultantisfoundtohavesubmittedafalsecertification;oriftheConsultantisplacedontheScrutinizedCompanieswithActivitiesinSudanList,ScrutinizedCompanieswithActivitiesintheIranTerrorismSectorsList,ScrutinizedCompanieswithActivitiesinIranPetroleumEnergySectorList,orengagedwithbusinessoperationsinCubaorSyriaduringthetermoftheAgreement.243.E-VerifyAffidavit.InaccordancewithSection448.095,FloridaStatutes,theCityrequiresallcontractorsdoingbusinesswiththeCitytoregisterwithandusetheE-Verifysystemtoverifytheworkauthorizationstatusofallnewlyhiredemployees.TheCitywillnotenterintoacontractunlesseachpartytothecontractregisterswithandusestheE-Verifysystem.ThecontractingentitymustprovideofitsproofofenrollmentinE-Verify.Forinstructionsonhowtoprovideproofofthecontractingentity’sparticipation/enrollmentinE-Verify,pleasevisit:https://www.e-verify.gov/faq/how-do-i-provide-proof-of-my-participationenrollment-in-e-verify.ByenteringintothisAgreement,theConsultantacknowledgesthatithasreadSection448.095,Florida9of87 Statutes;willcomplywiththeE-VerifyrequirementsimposedbySection448.095,FloridaStatutes,includingbutnotlimitedtoobtainingE-Verifyaffidavitsfromsubcontractors;andhasexecutedtherequiredaffidavitattachedheretoandincorporatedherein.24.4.NoncoerciveConductAffidavit.PursuanttoSection787.06,FloridaStatutes,anongovernmentalentityexecuting,renewing,orextendingacontractwithagovernmentalentityisrequiredtoprovideanaffidavit,signedbyanofficerorarepresentativeofthenongovernmentalentityunderpenaltyofperjury,attestingthatthenongovernmentalentitydoesnotusecoercionforlabororservicesasdefinedinSection787.06(2)(a),FloridaStatutes.ByenteringintothisAgreement,theConsultantacknowledgesthatithasreadSection787.06,FloridaStatutes,andwillcomplywiththerequirementstherein,andhasexecutedtherequiredaffidavitattachedheretoandincorporatedherein.24.5.ProhibitiononContractingwithEntitiesofForeignConcern.PursuanttoSection287.138,FloridaStatutes(whichisexpresslyincorporatedhereinbyreference),agovernmentalentitymaynotknowinglyenterintoacontractwithanentitywhichwouldgiveaccesstoanindividual’spersonalidentifyinginformationif(a)theentityisownedbythegovernmentofaforeigncountryofconcern;(b)thegovernmentofaforeigncountryofconcernhasacontrollinginterestintheentity;or(c)theentityisorganizedunderthelawsoforhasitsprincipalplaceofbusinessinaforeigncountryofconcern.ByenteringintothisAgreement,theConsultantacknowledgesthatithasreadSection287.138,FloridaStatutes,andcomplieswiththerequirementstherein,andhasexecutedtherequiredaffidavitattachedheretoandincorporatedherein.25.Counterparts.ThisAgreementmaybeexecutedinseveralcounterparts,eachofwhichshallbedeemedanoriginalandsuchcounterpartsshallconstituteoneandthesameinstrument.26.Conflicts;OrderofPriority.Thisdocumentwithoutexhibitsisreferredtoasthe“BaseAgreement.”IntheeventofaconflictbetweenthetermsofthisAgreementandanyexhibitsorattachmentshereto,oranydocumentsincorporatedhereinbyreference,theconflictshallberesolvedinthefollowingorderofprioritiesandthemorestringentcriteriaforperformanceoftheServicesshallapply:26.1.FirstPriority:BaseAgreement;26.2.SecondPriority:ExhibitA-ScopeofServices;263.ThirdPriority:ExhibitC-RateSchedule;26.4.FourthPriority:theRFP;and26.5.FifthPriority:ExhibitB-Proposal.[Remainderofpageintentionallyleftblank.SignaturepageandStateRequiredAffidavitsfollow.]10of87 INWITNESSWHEREOF,thepartiesheretohavecausedthisAgreementtobeexecutedthedayandyearasfirststatedabove.FLORIDAPREFERREDGROUP,LLCEntity:ROH^CCfIttC1^6By:IName:'^Approvedastofont)andlegalsufficiency:AddressesforNotice:Genaro“Chip”IglesiasCityofSouthMiamiAttn:CityManager6130SunsetDriveSouthMiami,FL33143305-668-2510(telephone)305-663-6345(facsimile)chip@southmiamifl.gov(email)AddressesforNotice:3-&ifl'3(telephone)(facsimile)(email)Withacopyto:WeissSerotaHelfmanCole&Bierman,P.L.Attn:LillianArango,Esq.CityofSouthMiamiAttorney2800PoncedeLeonBoulevard,Suite1200CoralGables,FL33134larango@wsh-law.com(email)Withacopyto:(telephone)(facsimile)(emai1)11of87 E-VERIFYAFFIDAVITInaccordancewithSection448.095,FloridaStatutes,theCityrequiresallcontractorsdoingbusinesswiththeCitytoregisterwithandusetheE-Verifysystemtoverifytheworkauthorizationstatusofallnewlyhiredemployees.TheCitywillnotenterintoacontractunlesseachpartytothecontractregisterswithandusestheE-Verifysystem.ThecontractingentitymustprovideofitsproofofenrollmentinE-Verify.Forinstructionsonhowtoprovideproofofthecontractingentity’sparticipation/enrollmentinE-Verify,pleasevisit:https://www.e-verify.gov/faq/how-do-i-provide-proof-of-mv-participationenrollment-in-e-verifyBysigningbelow,thecontractingentityacknowledgesthatithasreadSection448.095,FloridaStatutesandwillcomplywiththeE-Verifyrequirementsimposedbyit,includingbutnotlimitedtoobtainingE-Verifyaffidavitsfromsubcontractors.CheckheretoconfirmproofofenrollmentinE-VerifyhasbeenattachedtothisAffidavit.of:InthepresWitness#2PrintName:WitnessffWPsintName:yWfMjloESigned,se^Tddanddeliveredby:EntityName:StateofFloridaCountyoff-BotviLACKNOWLEDGMENTrTypeasNotaiyPubif&.(Print,SCommissioned)Personallyknowntome;orProducedidentification(TypeofIdentification:Didtakeanoath;orDidnottakeanoathhJANETDEPAZOSMYCOMMISSIONSHH212473EXPIRES:January22,2026Theforegoinginstrumentwasacknowledgedbeforemebymeansof^physicalpresenceoronlinenotarization,this2^dayofClL,2Q2S\by(nameofperson)asCl^O1(typeofauthority)forrift(nameofpartyonbehalfofwhominstrumentisexecuted).CityofSouthMiami12of87E-VerifyAffidavit AFFIDAVITATTESTINGTONONCOERCIVECONDUCTFORLABORORSERVICESEffectiveJuly1,2024,Section787.06,FloridaStatutes,anongovernmentalentityexecuting,renewing,orextendingacontractwithagovernmentalentityisrequiredtoprovideanaffidavit,signedbyanofficerorarepresentativeofthenongovernmentalentityunderpenaltyofperjury,attestingthatthenongovernmentalentitydoesnotusecoercionforlabororservicesasdefinedinSection787.06(2)(a),FloridaStatutes.Bysigningbelow,Iherebyaffirmunderpenaltyofperjurythat:1.1havereadSection787.06,FloridaStatutes,andunderstandthatthisaffidavitisprovidedincompliancewiththerequirementthat,uponexecution,renewal,orextensionofacontractbetweenanongovernmentalentity-andagovernmentalentity,thenongovernmentalentitymustattesttotheabsenceofcoercioninlabororservices.2.3.Iamanofficerorrepresentativeofnongovernmentalentity.doesnotusecoercionforlabororservicesasdefinedintherelevantsectionofthelaw.Inthepresenceof:(Witness#1PrintName:1^1•Witness#2PnntName:yknl-fUnderpenaltiesofperjury,IdeclarethatIforegoingandthefactsstatedhaveresinitarePrintNamPUT/~EntityName:Cf^Td*StateofFloridaCountyofOATHORAFFIRMATIONnan^of^^o^behalfofwhominstrumentisexecuted).JANETDEPAZOSI,orTypeasNotary"Public(PriCommissioneSwornto(oraffirmed)andsubscribedbeforemebymeansof^physicalpresenceoronlinenotarization,this2'^dayofS-^cvej,202S,by„nor>01k|<(nameofperson)asC1.&.O.11(typeofautlrority)forCoCUpPersonallyknowntome;orProducedidentification(TypeofIdentification:Didtakeanoath;orDidnottakeanoathtHMYCOMMISSIONfHH212473EXPIRES:Jenuaiy22,202«CityofSouthMiamiNoncoerciveConductforLabororServicesAffidavit13of87 AFFIDAVITREGARDINGPROHIBITIONONCONTRACTINGWITHENTITIESOFFOREIGNCOUNTRIESOFCONCERNPursuanttoSection287.138,FloridaStatutes(whichisexpresslyincorporatedhereinbyreference),agovernmentalentitymaynotknowinglyenterintoacontractwithanentitywhichwouldgiveaccesstoanindividual’spersonalidentifyinginformationif(a)theentityisownedbyethegovernmentofaforeigncountryofconcern;(b)thegovernmentofaforeigncountryofconcernhasacontrollinginterestintheentity;or(c)theentityisorganizedunderthelawsoforhasitsprincipalplaceofbusinessinaforeigncountryofconcern.Thisaffidavitmustbecompletedbyanofficerorrepresentativeofanentitysubmittingabid,proposal,orreplyto,orenteringinto,renewing,orextending,acontractwithagovernmentalentitywhichwouldgranttheentityaccesstoanindividual’spersonalidentifyinginformation.i.(“entity”)doesnotmeetanyofthecriteriainparagraphs(2)(a)-(c)ofSection287.138,F.S.Inthepresenceof:Witness#2PrintName:Witness#!PrinftName:.)(uaninrue:Underpenaltiesofperjury,IdeclarethatIhaver^dtheforegoingandthefactsstatedTitle:CCGEntityName:PrintJN^gStateofFloridaCountyofOATHORAFFIRMATIONSwornto(oraffirmed)andsubscribedbeforemebymeansof^physicalpresenceoronlinenotarization,thisX*^dayofV-Pqu,20"ZS,bykQcreS(nameofperson)asQp^O,*(typeofauthority)forl^Voh.(nameofpartyonbehalfofwhominstrumentisexecuted)./"xCt—yNotaryRirtJfic(PrinLStainpPorTypeasCommissioned)—zVXPersonallyknowntome;orProducedidentification(TypeofIdentification:)Didtakeanoath;orDidnottakeanoathCityofSouthMiamiProhibitiononContractingwithEntitiesofForeignCountriesofConcern14of87 EXHIBIT“A”SCOPEOFSERVICES3.1GeneralRequirements:TheCityofSouthMiamiisseekingproposalsfromexperiencedandcapablepartiestoprovidejanitorialservicesforallCityfacilitiesandbuildings.TheContractormustfurnishallmaterial,labor,suppliesandequipmentnecessarytoperformalloperationsinconnectionwithdailyjanitorialservicesfortheCityofSouthMiami.Thetermofthisagreementwillbeforaperiodofthree-years(3),withone(1)two-year(2)Optionto-RenewfromthedateofexecutionoftheagreementbetweentheCityandContractoratthediscretionoftheCityManager.3.2SiteSpecificationsandLocation:PleaserefertoAttachmentC,“JanitorialServiceLocationsMatrix,”andAttachmentD,“PhotographsofFloorTypesinServiceAreas,”fordetailsofeachfacilityidentifiedforthisproject;includingestimatedSquareFeet,Restrooms,Appliances,SinksandCounters,WindowsandWaterFountains.Cityfacilitiesandaddressesaredescribedas:a)CommunityCenter(Multi-Purpose,Arts&CraftsComputerLab&EducationRoom)-5800SW66Street,SouthMiami,FL33143oServiceHours:Monday-Friday6AMto12PMb)IndoorBasketballGymnasium-5800SW66Street,SouthMiami,FL33143oServiceHours:Monday-Friday6AMto12PMc)MarshallWilliamsonbuilding,commonlyknownasMobleybuilding-5825Southwest68thStreet,SouthMiami,FL33143oServiceHours:Monday-Friday12PMto4PMd)SeniorCitizensCenter-6701SW62Avenue,SouthMiami,Fl33143oServiceHours:Monday-Friday12:30to4PM3.3ResponsibilitiesoftheParties:TheContractormustperformalldutiesandprovidetherequiredmaterial,labor,suppliesandequipmentasidentifiedbelow:a)OFFICES-DailyService1.Emptyallwastereceptacles,removingwastetodesignatedareafordisposal,andreplaceplasticliners2.Emptyanddampwipegarbagereceptacles,3.Dustandspotcleanalldesktopsandcountertops.4.Dustallhorizontalsurfacesofdesks,chairs,tablesandofficeequipment.5.Dustallexposedfilingcabinets,bookcasesandshelves.6.Dustallhorizontalsurfacesofequipment,ledges,andsills,shelves,ventilatinglouvers,frames,partitions,etc.7.Cleanandsanitizealldrinkfountains.8.Removecobwebsfromwallsandceilings.CityofSouthMiami15of.87Exhibit“A” 9.Spotwashglasssurfaces(includingwindows),doors,frames,kickandpushplates,handles,lightswitches,baseboards,andsimilarsurfaces.Allsurfaceswillbecleanedwiththeutmostcare.10.Vacuumcleanallexposedcarpeting.11.Inspectcarpetforspotsandstains,removewherepossible.12.Dustmoporsweepallnon-carpetedfloorsthoroughlyusingachemicallytreatedmop.13.Mopuncarpetedfloorsasneeded,minimum3timesperweek.14.Spotcleanspillswithadampmop.15.Beforeleavinganyoffice,shutofflights,electricalappliances,andshutdoor(s)16.Removefingerprintsandsmudgesfromallwalls.17.Reportallburnedoutlights.18.Detailandcleanallkitchen,countertops,orlunchroomareas,whereapplicable19.CleanStairsdaily,whereapplicable.20.Clean/WipeDownOfficeDesksb)CommunityCenter(Muli-Purpose,Arts&Crafts,ComputerLab&EducationsRoom:DAILYSERVICE:1Sweep&Mop2EmptyTrashReceptaclesc)IndoorBasketballGymnasium:1Sweepallareas:DAILY2MatsVacuumed:DAILY3Bleacherssweptandwipeddown:OnceperWeek4Basketballbackboardssqueegeed:OnceperWeekd)OFFICES-WeeklyService1.Dustallledges,wallmoldings,pictures,shelves,andothersurfacesabove[handheight].2.Brushdownandcleanallventsandgrills3.Cleanallbaseboards.4.Dustalllightfixturesandcovers.5.Cleanallgroundlevelwindowsandglasspartitionse)OFFICES-MonthlyService(CommunityCenterOnly)1.Waxandbufffloors.f)OFFICES-QuarterlyService1.Dustandcleanorvacuumalldrapesandblinds.2.Detailandvacuumchairsandupholsteredfurniture.3.Dustandcleanalllightfixturesandcovers.4.Scrubandwaxvinylfloors.g)BI-ANNUALSERVICEDeepcleaning,allcarpetsatallCityfacilities.Thoroughlycleanalloutsidewindowsandglasspartitions.Thismayalsoincludeadditionalrequestforserviceduringthiscleaningsession.(Stainremovaletc.)h)RESTROOMS-DailyService1.Emptytrashcontainersandremovetrashtodesignatedarea.CityofSouthMiamit6af87Exhibit“A’ 2.Dampwipeorscrubandsanitizealltrashcontainers.3.AllCommodes,urinals,andbasinstobescouredanddisinfected.Bothsidesoftoiletseattobecleaneddaily.4.Cleanandpolishallfaucets,sinks,andexposedmetal.5.Allpipingtobecleanedandpolished.6.Allpartitionstobespotcleanedandwashedasnecessary.7.Replenishallpaperproducts,includingtoiletcovers,papertowelsandtoiletpaperdaily.8.Replenishhandsoapdaily.9.Sweeptilefloorsanddampmopwithgermicidaldisinfectant.i)RESTROOMS-WeeklyService1.Washdownallwallsandsanitizeallpartitions.2.Washallwastecontainersanddisinfect.3.Cleanandpolishalldoors,doorplates,andhardware.4.Allfloorscleanedandgroutcleaned.5.Cleanshowers.j)RESTROOMS-MonthlyService1.Wipecleanallceilings,lights,andfixtures.2.Detailalltoiletcompartmentsandfixtures.3.Brushandcleangrillsandvents.4.Cleanshowercurtainsandshowerheads.5.Cleanwalltile(s)k)RESTROOMS-QuarterlyService1.Scruballtilefloors.1)EMERGENCYSERVICE-AsNeeded:TheContractormustprovideanEmergency“After-Hours/Weekends/Holidays”contactforemergencyjanitorialservicesthatmayoccurinanyoftheCityfacilitiesandbuildings.TheCitywillcontacttheContractorandadvisethenatureoftheemergencyservicesthatarerequired.Afterinspection,theContractorwillprovideaquotationtotheheadofthePublicWorksDepartmentordesigneefortheemergencyservices.EmergencyservicesareadditionalandarenotincludedinDaily,Weekly,Monthly,QuarterlyorBi-Annualservicesandtheyincludebutnotbelimitedto;ElectrostaticDisinfectingServicesusingEPA(EnvironmentalProtectionAgency)approvedcurrentdisinfectantslisting:“ListN:ProductswithEmergingViralPathogensandHumanCoronavirusClaimsforuseAgainstSARS-CoV-2;inaccordancewithwww.epa.gov/pesticide-registration/list-n-disinfectnats-use-against-sarscovlTheContractormustrespondtotheCitywithintwo(2)hoursfromreceivingtheEmergencycallfromtheCity.TheCitywillprovidetheContractorandtheirqualifiedpersonnelaccesstoallCityfacilitiesandjanitorialstorageareasduringthehoursofservices,orasagreed,toperformjanitorialservices.3.4BackgroundScreening:AllselectedContractor’spersonnelprovidingserviceatCityfacilitiesmustbeincompliancewithLevelIIBackgroundScreeningandfingerprintingrequirementsasperAttachmentEChapter435,includingbutnotlimitedtoFloridaStatute435.04,EmploymentScreening,priortothescheduledstartdateofjanitorialCityofSouthMiami17<487Exhibit“A” services.TheContractorisresponsiblefortheBackgroundScreeningsand,allcompletedBackgroundScreeningsmustbeapprovedbytheCityofSouthMiamiPoliceDepartmentpriortothescheduledstartdateforjanitorialservicesandpriortothestartofanyemployeesnotpreviouslyscreened.3.5Qualifications:TheselectedRespondentand/oritssubcontractors(asapplicable)musthave:1.aminimumoffive(5)yearspriorexperienceincommercialjanitorialservices.2.knowledgeofbusinessoperationsandthelegalrequirementsassociatedwiththistypeofoperation3.DemonstratedfinancialabilitytoperformtheresponsibilitiesoftheAgreement4.Threeprofessionalreferences,includingcontracts/firmscurrentlyservicing.5.Backgroundinformationonpersonsofsignificantresponsibilitywithintheproposer’sorganization.3.6JanitorialServicesLocations(6Buildings,4Locations)NOTE:RefertoAttachmentC,“JanitorialServiceLocationsMatrix,”andAttachmentD,“PhotographsofFloorTypesinServiceAreas”foradetaileddescriptionoftheCityfacilitiesincludedwiththisproject,includingestimatedsquarefootage,restrooms,appliances,sinksandcounters,waterfountains,etc.NOTE:ABIDBONDISNOTREQUIREDFORTHISPROJECTParksandRecreationDepartmentMaintenanceAreasGibson-BethelCommunityCenter&IndoorBasketballGym5800SW66thStreetAdministrationOfficeCityofSouthMiami18of87Exhibit“A’ DownstairsBathroomsMenWomenKitchenAreaCityofSouthMiami19of.87Exhibit“A” UpstairsBathroomsMenWomenFitnessCenterCityofSouthMiami20<487Exhibit“A” MarshallWilliamson/MobleyBuilding5825SW68thStreetSuite100-400Suite300:Entrance&BathroomCityofSouthMiami21of87Exhibit“A” SouthMiamiSeniorCenter6701SW62ndAvenueOffice,Lunchroom,KitchenCityofSouthMiami22<487Exhibit“A” EXHIBIT“B”CONSULTANT’SPROPOSALCityofSouthMiami23of87Exhibit“B” SouthTMiamiIHLCI1YOhPLEASAN7LIVINGFLORIDAPREFERREDGROUPPROPOSALTOCITYOFSOUTHMIAMIRFPNO.FN2024-17FOR“JANITORIALSERVICES”Addressedto:StevenP.KulickCityofSouthMiamiChiefProcurementOfficer6130SunsetDriveCityofSouthMiami,FL33143Email:skulick@southmiamifl.govProjectManager:JenniferOves(786)643-6853info@floridapreferredgroup.com(786)643-6853Qlinfo@floridapreferredgroup.comwww.floridapreferredgroup.com3806SW148thAvenue,Miami,FL,33185124of87 TABLEOFCONTENTSLETTEROFINTERESTpg.3PROPOSALFORMPACKAGEpg.5FORM1pg.5FORM2Apg.7FORM3pg.8FORM4pg.15FORM5pg.16FORM6pg.17FORM7pg.20FORM8pg.22FORM9pg.32PROOFOFEXPERIENCEpg.34PREVIOUSPROJECTSpg.39PROPOSER’SQUALIFICATIONSpg.47SERVICEANDINCORPORATIONpg.49LICENSESpg.52PERSONNELQUALIFICATIONSpg.54KEYSTAFFpg.55ORGANIZATIONALCHARTpg.58INSURANCECERTIFICATESpg.59225of87 LETTEROFINTERESTJanuary22,2025CityofSouthMiami6130SunsetDriveCityofSouthMiami,FL33143Towhomitmayconcern,I,JenniferOves,CEOofFloridaPreferredGroup,ampleasedtoexpressmyinterestintheRequestforProposal(RFP)forjanitorialservicesissuedbytheCityofSouthMiami.OurteamhasthoroughlyreviewedtheRFPandisfullypreparedtomeetallsubmittalrequirementsandaddresstheCity’suniqueneeds.FloridaPreferredGroupiscommittedtodeliveringexceptionalcleaningandmaintenanceservices,tailoredtoalignwiththestandardsandexpectationsoutlinedintheRFP.Ourapproachemphasizes:•CustomizedCleaningPlans:Tailoredtothespecificrequirementsofeachfacility,consideringfoottrafficandusagepatterns.•Sustainability:Incorporatingeco-friendlyproductsandpracticestominimizeenvironmentalimpact.•AdvancedEquipment:Utilizingstate-of-the-arttechnologiesforthoroughandefficientcleaning.•TrainedProfessionals:Adedicatedteamthatprioritizessafety,compliance,andattentiontodetail.•QualityAssurance:Regularinspectionsandfeedbackmechanismstoensureconsistentserviceexcellence.WeunderstandtheimportanceofmaintainingcleanandsafeenvironmentsfortheCity’semployeesandvisitors.Asareputableserviceprovider,weareeagertobringourexpertisetothispartnershipandexceedexpectationsthroughourdedicationtoqualityandefficiency.FPG’sapproachandphilosophyistakingprideinthecleanlinessofourfacilities,soourstandardincludesfocusingheavilyondetails.Workingwithourcompanyalsomeansbeingenvironmentallyconscious,sinceweuseproductsthatareenvironmentallyfriendly.Sincewehaveexperiencewiththeresources,equipment,staff,andservicesoutlinedintheRFP,FloridaPreferredGroupisconfidentthatwewillbeabletoexcelintherequiredfacilities.Allofourstaffgoesthroughseveralmandatorytrainingsessionsthatensuretheyarewellroundedontheconceptofproductusageandsafety/emergencyprocedures.FPG’sadministrationE-VerifiesalloftheiremployeesandrunstheirbackgroundchecksthroughADP.Inaddition,ouremployeeshaveaspecificuniformthatisdistributedtothemwhentheyarehired.326of87 FPGhasasetofsupervisorsandmanagersthataretrainedandqualifiedtoensurethattheemployeescanandwilldotheirjobscorrectly.Ifthereareanyissues,FPGhasasystemofreportingthatwilltakecareoftheproblemasquicklyaspossible.Supervisorsareresponsibleforcreatinganddeliveringacleaningplanthatworks.FPGasacompanywillmonitorthecleaningscheduletomakesureitisworking.Ifanythingneedstobechangedthesupervisorswillmaketheappropriatechanges.FPGusesaQualityControlSoftwarenamed“OrangeQC”whichensuresthatallemployeeshavetheknowledgetoperformtheirjob,andthatallemployeesarefollowingcompanyprotocolandobeyingthecleaningtasks.ItallowstheFPGQualityControlManagertoperformroutineinspectionsrightfromhertablet,monitoraccountperformances&sendrealtimealertsbasedontriggersyouset,andgeneratereportsforclients.Ifanything,otherthana“Satisfactory”isentered,thesystemwillprovideareportsuggestingactionstobetaken.Theenduseristorefertoasupervisor,immediateactionisrequired,orhighrisk(hazardoussituationstohealthorsafety).Thereportwillshowallsatisfactoryareasthatareinneedofattention.Aticketisthenissuedtothesupervisorand/ormanagerincharge.Theyareresponsibletocommunicateacopyofthereporttothecleanerssothattheyareabletoaddressallconcernsandcleartheticketwithin48hours.IftheCityofSouthMiamihasanycomplaints,FPGhasaplaninplacetohandlethesituation.FPGplanstohandlecomplaintsfromtheCityofSouthMiamiduetononperformancebyfirstaddressingthecomplaintonasituationalbasis.First,wewillevaluatethecomplaint,thendirectlyspeaktothesupervisorinchargeandassesstheissue.Wewillcreateaplantoproperlyaddresstheissuewithin24hoursandhavetheissuecorrectedwithin48hours.TheemployeewillbewrittenupandwillbecarefullymonitoredtoensurethatFPG’sstandardsaremet.Thankyouforconsideringourproposal.Shouldyouhaveanyquestionsorrequirefurtherclarificationonanyaspectofourproposalsubmission,pleasedonothesitatetocontactus.Weareeagertodiscussanyadditionaldetailsorrequirementsandareavailableforapresentationormeetingasneeded.Sincerely,JenniferOvesCEO,FloridaPreferredGroup3806SW148thAve,Miami,FL33185(786)838-8029|jenny@floridapreferredgroup.com421<487 PROPOSALFORMPACKAGEFORM1FORM1PROPOSALFORMPACKAGEACKNOWLEDGEMENTSIherebyproposetofurnishthegoodsandservicesspecifiedintheRequestforProposals,RFPNo.FN2024-17.IagreethatmyProposalwillremainfirmforaperiodof180daysafteropenedbytheCityinordertoallowtheCityadequatetimetoevaluatetheProposal.IcertifythatallinformationcontainedinthisProposalistruthfultothebestofmyknowledgeandbelief.IfurthercertifythatIamdulyauthorizedtosubmitthisProposalonbehalfoftheFirmnamedastheProposingFirmandthatsaidFirmisready,willing,andabletoperformifawardedtheAgreement.Ifurthercertify,underoath,thatthisProposalismadewithoutpriorunderstanding,agreement,connection,discussion,orcollusionwithanyotherperson,firmorcorporationsubmittingaProposal;noofficer,employeeoragentoftheCityofSouthMiamioranyotherProposerhasaninterestinsaidProposal.Furthermore,IcertifythattheundersignedexecutedthisProposalFormwithfullknowledgeandunderstandingofmattersthereincontainedandwasdulyauthorized.IfurthercertifythattheProposeracknowledgesreceiptofallAddendaissuedbytheCityinconnectionwiththeRFP(Checktheboxnexttoeachaddendumreceived).*Addendum1'Addendum2Addendum3Addendum4Addendum5Addendum6Addendum7Addendum8Addendum9Addendum10Attachedheretoarethefollowingforms/documentswhichformapartofthisProposal:Form1.ProposalFormPackageAcknowledgement.Form2A.Proposer'sCertification(ifCompanyorCorporation)Form2B.Proposer'sCertification(ifPartnership)Form3.SingleExecutionAffidavitsForm4.DisputeDisclosureForm5.CertificationRegardingDebarment,Suspension,&OtherResponsibilityMattersPrimaryCoveredTransactionsForm6.Proposer'sQualificationsSurveyForm7.PriceProposalFormForm8.ReferenceListForm9.KeyStaff&ProposedSubcontractors27of92528of87 FORM1PROPOSALFORMPACKAGEACKNOWLEDGEMENTS(CONTINUED)NAMEOF/PROPOSERFIRMSIGNATUkpOFPROPOSERnnKCr(MJ,(CONAME&TITLE,TYPEbORPRINTEDMAILINGADDRESS.woftpMt-/Wimi,Pl3)^^mTELEPHONENUMBERStateofFloridaCountyofDod€-Producedidentification(TypeofIdentification:Didtakeanoath;orDidnottakeanoath-NotaryPublic(Print,Stamp,orTypeasCommissioned)Theforegoinginstrumentwasacknowledgedbeforemebymeansofc0\physicalpresenceor_onlinenotarization,thisZZ-dayofJLlnCiLlnJ,20O,byjCnnif€CQVtP(nameofperson)asCCT)(typeofauthority)forF)(V06ptTIfHTdJThameofpartyonbehalfofwhominstrumentisexecuted).NotifyPublicSlateofFfufidiI4aJennyCabreraIMyCommfMlonHH5H453IPersonally*knowntome;or28of92629a/87 FORM2AFORM2APROPOSER’SCERTIFICATION(ifCompanyorCorporation)CERTIFICATESTATEOF)COUNTYOF)IHEREBYCERTIFYthatameetingoftheBoardofDirectorsofPrf(f\rrdfrtiupLxCacorporationorcompanyexistingunderthelawsoftheStateof)-)PK/^A.,heldonJLvlUAflJ,202&thefollowingresolutionwasdulypassedandadopted:RESOLVED,that,asCoftheCorporation/Company,beandisherebyauthorizedtoexecutetheProposaldated,202$totheCityofSouthMiamiforRFPNo.FN2024-17“JanitorialServices,”andthatthisexecutionthereof,attestedbytheSecretaryoftheCorporation/Company,andwiththeCorporate/CompanySealaffixed,shallbetheofficialactanddeedofthisCorporation/Company.Ifurthercertifythatsaidresolutionisnowinfullforceandeffect.INWITNESSWHEREOF,Ihavecorporation/companyonthistheNoUryPublicStoleolFloridaJennyCabrera]MyCommissionhh571453Expires7/13/202829of92730of87 FORM3FORM3SINGLEEXECUTIONAFFIDAVITSThisformmustbesignedandsworntointhepresenceofanotarypublicOROTHEROFFICIALAUTHORIZEDTOADMIMSTEROATHS.THISFORMCOMBINESSEVERALAFFIDAVITSTATEMENTSTOBESWORNTOBYTHEPROPOSERORPROPOSERANDNOTARIZEDBELOW.INTHEEVENTTHEPROPOSERORPROPOSERCANNOTSWEARTOANYOFTHESEAFFIDAVITSTATEMENTS,THEPROPOSERORPROPOSERISDEEMEDTOBENON¬RESPONSIBLEANDISNOTELIGIBLETOSUBMITAPROPOSAL/PROPOSAL.THESESINGLEEXECUTIONAFFIDAVITSARESUBMITTEDTOTHECITYOFSOUTHMIAMIANDARESTATEMENTSMADE:By:JHlnHCrFor(NameofProposingorBiddingEntity):PrCfcrrdWhosebusinessaddressis:/VlfM/yni/(x33/^S’And(ifapplicable)itsFederalEmployerIdentificationNumber(FEIN)is:5S(iftheentitydoesnothaveanFEIN,includetheSocialSecurityNumberoftheindividualsigningthisswornstatement.SS#:)AmericanswithDisabilitiesActComplianceAffidavitTheabovenamedfirm,corporationororganizationisincompliancewithandagreestocontinuetocomplywith,andassurethatanysubcontractor,orthirdpartycontractorunderthisprojectcomplieswithallapplicablerequirementsofthelawslistedbelowincluding,butnotlimitedto,thoseprovisionspertainingtoemployment,provisionofprogramsandservices,transportation,communications,accesstofacilities,renovations,andnewconstruction.•TheAmericanwithDisabilitiesActof1990(ADA),Pub.L.101-336,104Stat327,42USC1210112213and47USCSections225and661includingTitleI,Employment;TitleII,PublicServices;TitleIII,PublicAccommodationsandServicesOperatedbyPrivateentities;TitleIV,Telecommunications;andTitleV,MiscellaneousProvisions.•TheFloridaAmericanswithDisabilitiesAccessibilityImplementationActof1993,Section553.501-553.513,FloridaStatutes:•TheRehabilitationActof1973,229USCSection794;•TheFederalTransitAct.asamended49USCSection1612;•TheFairHousingActasamended42USCSection3601-3631.ProposerInitials31of92831487 PublicEntityCrimesAffidavitJunderstandthata"publicentitycrime”asdefinedinParagraph287.133(1)(g),FloridaStatutes,meansaviolationofanystateorfederallawbyapersonwithrespecttoanddirectlyrelatedtothetransactionofbusinesswithanypublicentityorwithanagencyorpoliticalsubdivisionofanyotherstateoroftheUnitedStates,includingbutnotlimitedto,anyProposalorcontractforgoodsorservicestobeprovidedtoanypublicentityoranagencyorpoliticalsubdivisionofanyotherstateoroftheUnitedStatesandinvolvingantitrust,fraud,theft,bribery,collusion,racketeering,conspiracy,ormaterialmisrepresentations.Iunderstandthat"convicted”or"conviction"asdefinedinParagraph287.133(I)(b).FloridaStatutes,meansafindingofguiltoraconvictionofapublicentitycrime,withorwithoutanadjudicationofguilt,inanyfederalorstatetrialcourtofrecordrelatingtochargesbroughtbyindictmentorinformationafterJulyI,1989,asaresultofajuryverdict,non-jurytrial,orentryofapleaofguiltyornolocontendere.Iunderstandthatan"affiliate"asdefinedinParagraph287.133(I)(a).FloridaStatutes,means:1.Apredecessororsuccessorofapersonconvictedofapublicentitycrime;or2.Anentityunderthecontrolofanynaturalpersonwhoisactiveinthemanagementoftheentityandwhohasbeenconvictedofapublicentitycrime.Theterm"affiliate”includesthoseofficers,directors,executives,partners,shareholders,employees,members,andagentswhoareactiveinthemanagementofanaffiliate.Theownershipbyonepersonofsharesconstitutingacontrollinginterestinanotherperson,orapoolingofequipmentorincomeamongpersonswhennotforfairmarketvalueunderanarm’slengthagreement,shallbeaprimafaciecasethatonepersoncontrolsanotherperson.ApersonwhoknowinglyentersintoajointventurewithapersonwhohasbeenconvictedofapublicentitycrimeinFloridaduringthepreceding36monthsshallbeconsideredanaffiliate.Iunderstandthata"person"asdefinedinParagraph287.133(1)(e),FloridaStatutes,meansanynaturalpersonorentityorganizedunderthelawsofanystateoroftheUnitedStateswiththelegalpowertoenterintoabindingcontractandwhichproposalsorappliestoProposaloncontractsfortheprovisionofgoodsorservicesletbyapublicentity,orwhichotherwisetransactsorappliestotransactbusinesswithapublicentity.Theterm"person”includesthoseofficers,directors,executives,andpartners,shareholders,employees,members,andagentswhoareactiveinmanagementofanentity.Basedoninformationandbelief,thestatement,whichIhavemarkedbelow,istrueinrelationstotheentitysubmittingthisswornstatement.(INDICATEWHICHSTATEMENTAPPLIES.)./Neithertheentitysubmittingthisswornstatement,noranyofitsofficers,directors,Executives,partners,shareholders,employees,members,oragentswhoareactiveinthemanagementoftheentity,noranyaffiliateoftheentityhasbeenchargedwithadconvictedofapublicentitycrimesubsequenttoJuly1,1989.Theentitysubmittingthisswornstatement,oroneormoreofitsofficers,directors,executives,partners,shareholders,employees,members,oragentswhoareactiveinthe32of92932of87 managementoftheentity,oranaffiliateoftheentityhasbeenchargedwithandconvictedofapublicentitycrimesubsequenttoJuly1.1989.Theentitysubmittingthisswornstatement,oroneormoreofitsofficers,directors,executives,partners,shareholders,employees,members,oragentswhoareactiveinthemanagementoftheentity,oranaffiliateoftheentityhasbeenchargedwithandconvictedofapublicentitycrimesubsequenttoJulyI,1989.However,therehasbeenasubsequentproceedingbeforeaHearingOfficeroftheStateofFlorida.DivisionofAdministrativeHearingsandthefinalOrderenteredbytheHearingOfficerdeterminedthatitwasnotinthepublicinteresttoplacetheentitysubmittingthisswornstatementontheconvictedvendorlist(attachacopyofthefinalorder).IunderstandthatthesubmissionofthisformtothecontractingofficerforthepublicentityidentifiedinparagraphIaboveisforthatpublicentityonlyandthatthisformisvalidthroughDecember31ofthecalendaryearinwhichitisfiled.IalsounderstandthatIamrequiredtoinformthepublicentitypriortoenteringintoacontractinexcessofthethresholdamountprovidedinSection287.017,FloridaStatutesforcategorytwoofanychangeintheinformationcontainedinthisform.ProposerInitialsNoConflictofInterestorContingentFeeAffidavitProposerwarrantsthatneitheritnoranyprincipal,employee,agent,representativenorfamilymemberhaspaidorwillpayanyfeeorconsiderationthatiscontingentontheawardorexecutionofacontractarisingoutofthissolicitation.Proposeralsowarrantsthatneitheritnoranyprincipal,employee,agent,representativenorfamilymemberhasprocuredorattemptedtoprocurethiscontractinviolationofanyoftheprovisionsoftheMiami-DadeCountyandCityofSouthMiamiconflictofinterestorcodeofethicsordinances.Further.ProposeracknowledgesthatanyviolationofthesewarrantswillresultintheterminationofthecontractandforfeitureoffundspaidortobepaidtotheProposershouldtheProposerbeselectedfortheperformanceofthiscontract.ProposerInitialsBusinessEntityAffidavitProposerherebyrecognizesandcertifiesthatnoelectedofficial,boardmember,oremployeeoftheCityofSouthMiami(the"City")shallhaveafinancialinterestdirectlyorindirectlyinthistransactionoranycompensationtobepaidunderorthroughthistransaction,andfurther,thatnoCityemployee,noranyelectedorappointedofficer(includingCityboardmembers)oftheCity,noranyspouse,parentorchildofsuchemployeeorelectedorappointedofficeroftheCity,maybeapartner,officer,directororproprietorofProposerorVendor,andfurther,thatnosuchCityemployeeorelectedorappointedofficer,orthespouse,parentorchildofanyofthem,aloneorincombination,mayhaveamaterialinterestintheVendororProposer.Materialinterestmeansdirectorindirectownershipofmorethan5%ofthetotalassetsorcapitalstockoftheProposer.Anyexceptiontotheseabovedescribedrestrictionsmustbeexpresslyprovidedb)applicablelaworordinanceandbeconfirmedinwritingbyCity.Further.ProposerrecognizesthatwithrespecttothistransactionorProposal,ifanyProposerviolatesorisapartytoaviolationoftheethics3Jof921033of87 ordinancesorrulesoftheCity,theprovisionsofMiami-DadeCountyCodeSection2-11.1,asapplicabletoCity,ortheprovisionsofChapter112,partIII.Fla.Stat.,theCodeofEthicsforPublicOfficersandEmployees,suchProposermaybedisqualifiedfromfurnishingthegoodsorservicesforwhichtheProposalorProposalissubmittedandmajbefurtherdisqualifiedfromsubmittinganyfutureproposalsorProposalforgoodsorservicestoCity.ProposerInitialsAnti-CollusionAffidavitI.Proposcr/ProposcrhaspersonalknowledgeofthematterssetforthinitsProposal/ProposalandisfullyinformedrespectingthepreparationandcontentsoftheattachedProposal/ProposalandallpertinentcircumstancesrespectingtheProposal/Proposal;2.TheProposal/ProposalisgenuineandisnotacollusiveorshamProposal/Proposal:and3.NeithertheProposer/Proposernoranyofitsofficers,partners,owners,agents,representatives,employees,orpartiesininterest,includingAffiant,hasinanywaycolluded,conspired,connived,oragreed,directlyorindirectlywithanyotherProposer/Proposer.firm,orpersontosubmitacollusiveorshamProposal/Proposal.orhasinanymanner,directlyorindirectly,soughtbyagreementorcollusionorcommunicationorconferencewithanyotherProposer/Proposer.firm,orpersontofixthepriceorpricesintheattachedProposal/ProposalorofanyotherProposer/Proposer,ortofixanyoverhead,profit,orcostelementoftheProposal/ProposalpriceortheProposal/ProposalpriceofanyotherProposer/Proposer.ortosecurethroughanycollusion,conspiracy,connivanceorunlawfulagreementanyadvantageagainsttheCityoranypersoninterestedintheproposedContract.ProposerInitialsScrutinizedCompanyCertification1.ProposercertifiesthatitanditssubcontractorsarenotontheScrutinizedCompaniesthatBoycottIsraelList.PursuanttoSection287.135,F.S.,theCitymayimmediatelyterminatetheAgreementthatmayresultfromthisRFPatitssoleoptioniftheProposeroritssubcontractorsarefoundtohavesubmittedafalsecertification:oriftheProposer,oritssubcontractorsareplacedontheScrutinizedCompaniesthatBoycottIsraelListorisengagedintheboycottofIsraelduringthetermoftheAgreement.2.IftheAgreementthatmayresultfromthisRFPisformorethanonemilliondollars,theProposercertifiesthatitanditssubcontractorsarealsonotontheScrutinizedCompanieswithActivitiesinSudan.ScrutinizedCompanieswithActivitiesintheIranPetroleumEnergySectorList,orengagedwithbusinessoperationsinCubaorSyriaasidentifiedinSection287.135.F.S.pursuanttoSection287.135.F.S..theCitymayimmediatelyterminatetheAgreementthatmayresultfromthisRFPatitssoleoptioniftheProposer,itsaffiliates,oritssubcontractorsarefoundtohavesubmittedafalsecertification;oriftheProposer,itsaffiliates,oritssubcontractorsareplacedontheScrutinizedCompanieswithActivitiesinSudanList,or34orvz1134of87 ScrutinizedCompanieswithActivitiesintheIranPetroleumEnergySectorList,orengagedwithbusinessoperationsinCubaorSyriaduringthetermoftheAgreement.3.TheProposeragreestoobservetheaboverequirementsforapplicablesubcontractsenteredintofortheperformanceofworkundertheAgreementthatmayresultfromthisRFP.AsprovidedinSubsection287.135(8).F.S..iffederallawceasestoauthorizetheabove-statedcontractingprohibitionsthentheyshallbecomeinoperative.yoProposerInitialsDrug-FreeWorkplaceAffidavitProposerherebyrecognizesthat,pursuanttoF.S.§287.087.preferenceshallbegiventobusinesseswithdrug-freeworkplaceprogramswhentwoproposals/Proposalareequalwithrespecttoprice,quality,andservice.Proposerunderstandsthatinordertoqualifyasadrug-freeworkplace.Proposermust:a)Publishastatementnotifyingemployeesthattheunlawfulmanufacture,distribution,dispensing,possession,oruseofacontrolledsubstanceisprohibitedintheworkplaceandspecifyingtheactionsthatwillbetakenagainstemployeesforviolationsofsuchprohibition.b)Informemployeesaboutthedangersofdrugabuseintheworkplace,theProposer'spolicyofmaintainingadrug-freeworkplace,anyavailabledrugcounseling,rehabilitation,andemployeeassistanceprograms,andthepenaltiesthatmaybeimposeduponemployeesfordrugabuseviolations.I)GiveeachemployeeengagedinprovidingcommoditiesorcontractualservicesundertheRFPacopyofthestatementspecifiedinsubsection(I).2)Notifyemployeesthat,asaconditionofworkingonthecommoditiesorcontractualservicesundertheRFP.theemployeemustabidebythetermsofthestatementandwillnotifytheemployerofanyconvictionof,orpleaofguiltyornolocontendereto.anyviolationofchapter893orofanycontrolledsubstancelawoftheUnitedStatesoranystate,foraviolationoccurringintheworkplacenolaterthanfive(5)daysaftersuchconviction.3)Imposeasanctionon,orrequirethesatisfactoryparticipationinadrugabuseassistanceorrehabilitationprogramifsuchisavailableintheemployee’scommunity,byanyemployeewhoissoconvicted.4)Makeagoodfaithefforttocontinuetomaintainadrug-freeworkplacethroughtheimplementationofthissection.Basedoninformationandbelief,thestatement,whichIhavemarkedbelow,istrueinrelationstotheentitysubmittingthisswornstatement.(INDICATEWHICHSTATEMENTAPPLIES.)Theentitysubmittingthisswornstatementisadrug-freeworkplaceandisinfull35of921235<487 compliancewiththerequirementssetforthunderF.S.§287.087.Theentitysubmittingthisswornstatementisnotadrug-freeworkplace.-ID--ProposerInitialsCityNon-DiscriminationRequirementsAffidavitProposerunderstandsthatpursuanttoSection3-1.1oftheCodeoftheCityofSouthMiami,theCitywillnotenterintoorawardacontracttoanentityengagedinaboycott.Proposerunderstandsthat‘’Boycott"asdefinedunderSection3-1.1oftheCodeoftheCityofSouthMiamimeanstoblacklist,divestfrom,orotherwiserefusetodealwithanationorcountry,ortoblacklistorotherwiserefusetodealwithapersonorentitywhentheactionisbasedonrace,color,nationalorigin,religion,sex.genderidentity,sexualorientation,maritalorfamilialstatus,age,ordisabilityinadiscriminatorymanner.Thetermboycottdoesnotincludeadecisionbaseduponbusinessoreconomicreasons,orboycotts,embargoes,traderestrictions,ordivestmentsthatarespecificallyauthorizedorrequiredbyfederallaworstatelaw.Proposercertifiesthatitisnotengagedinaboycott,andisinfullcompliancewithSection3-1.1oftheCodeoftheCityofSouthMiami.ProposerInitialsAcknowledgment,Warranty',andAcceptance1.ContractorwarrantsthatitiswillingandabletocomplywithallapplicablestateofFloridalaws,rulesandregulations.2.Contractorwarrantsthatithasread,understands,andiswillingtocomplywithallrequirementsofRFPNo.FN2024-03andanyaddendum/addendarelatedthereto.3.ContractorwarrantsthatitwillnotdelegateorsubcontractitsresponsibilitiesunderanagreementwithoutthepriorwrittenpermissionoftheCityCommissionorCityManager,asapplicable.4.ContractorwarrantsthatallinformationprovidedbyitinconnectionwiththisProposalistrueandaccurate.ProposerInitials[REMAINDEROFPAGELEFTINTENTIONALLYBLANK.SIGNATUREPAGEFOLLOWS.)36of921336of«7 Inthepresenceof:Witness#1PrintName:Witness#2PrintName:'aViV'IiSigned;sealedanddeliveredby:Print^me/Jf'Pyi\-ff(LM73~Title:Opt)StateofFloridaCountyof(TmG(VmWoACKNOWLEDGMENTTheforegoinginstrumentwasacknowledgedbeforemebymeansofXphysicalpresenceor_onlinenotarization,this12-dayof-36mCv.20Zc;.bvxoi\J<i(Mt’S(nameofperson)as(+C'(typeofauthority)forG^o>p(namcofpart)onbehalfofwhominstrumentisexecuted).NotaryPublic(Print,Stamp,orTypeasCommissioned)Personallyknowntome;orProducedidentification(TypeofIdentification:,.NotaryPublicStalootFloridaJonnyCabreraMyCommissionhh571453Expire*7/13/2028)Didtakeanoath;orDidnottakeanoath37of921437<4SI FORM4FORM4DISPUTEDISCLOSUREAnswerthefollowingquestionsbyplacingan“X”after“Yes”or“No”.Ifyouanswer“Yes”,pleaseexplaininthespaceprovided,oronaseparatesheetattachedtothisform.1.Hasyourfirmoranyofitsofficers,receivedareprimandofan)natureorbeensuspendedbytheDepartmentofProfessionalRegulationsoranyotherregulatoryagencyorprofessionalassociationswithinthelastfive(5)years?YESNOY2.Hasyourfirm,oranymemberofyourfirm,beendeclaredindefault,terminatedorremovedfromacontractorjobrelatedtotheservicesyourfirmprovidesintheregularcourseofbusinesswithinthelastfive(5)years?YESNOX3.Hasyourfirmhadagainstitorfiledanyrequestsforequitableadjustment,contractclaims.Proposalprotests,orlitigationinthepastfive(5)yearsthatisrelatedtothesendeesyourfirmprovidesintheregularcourseofbusiness?YESNOyIfyes,statethenatureoftherequestforequitableadjustment,contractclaim,litigation,orprotest,andstateabriefdescriptionofthecase,theoutcomeorstatusofthesuitandthemonetaryamountsofextendedcontracttimeinvolved.1herebycertifythatallstatementsmadearetrueandagreeandunderstandthatanymisstatementormisrepresentationoffalsificationoffactsshallbecauseforforfeitureofrightsforfurtherconsiderationofthisProposalorProposalfortheCityofSouthMiami.StateofFlorida>„CountyoffAIfIQACKNOWLEDGMENTofIdentification:NotaryPublicStottdfundiJAJonnyCabreraIAmMyCommitofonhh571453>7/13/2028IProducedidentification(TypeDidtakeanoath;orDidnottakeanoathTheforegoinginstrumentwasacknowledgedbeforejnebymeansofX^physicalpresenceoronlinenotarization,thisday^of.202Sb\_JCFY}(nameofperson)35C-fOZ(typeofauthority)forHOV/XtPfTfCofpartyonbehalfofwhominstrumentisexecuted).38of921538of87 FORM5FORMSCERTIFICATIONREGARDINGDEBARMENT,SUSPENSION,ANDOTHERRESPONSIBILITYMATTERSPRIMARYCOVEREDTRANSACTIONSThiscertificationisrequiredbytheregulationsimplementingExecutiveOrder12549,DebarmentandSuspension,I3CFRPart145.TheregulationswerepublishedasPartVIIoftheMay26,1988FederalRegister(pages19160-19211).CopiesoftheregulationsareavailablefromlocalofficesoftheU.S.SmallBusinessAdministration.(1)Theprospectiveprimaryparticipantcertifiestothebestofitsknowledgeandbeliefthatitanditsprincipals:(a)Arenotpresentlydebarred,suspended,proposedfordisbarment,declaredineligible,orvoluntarilyexcludedfromcoveredtransactionsbyanyFederaldepartmentoragency;(b)Havenotwithinathree-yearperiodprecedingthisapplicationbeenconvictedoforhadaciviljudgmentrenderedagainstthemforcommissionoffraudoracriminaloffenseinconnectionwithobtaining,attemptingtoobtain,orperformingapublic(Federal,State,orlocal)transactionorcontractunderapublictransaction;violationofFederalorStateantitruststatutesorcommissionofembezzlement,theft,forgery,bribery,falsificationordestructionofrecords,makingfalsestatements,orreceivingstolenproperty;(c)Arenotpresentlyindictedfororotherwisecriminallyorcivillychargedbyagovernmentalentity(Federal,State,orlocal)withcommissionofanyoftheoffensesenumeratedinparagraph(I)(b)ofthiscertification;and(d)Havenotwithinathree-yearperiodprecedingthisapplicationhadoneormorepublictransactions(Federal,State,orlocal)terminatedforcauseordefault.(2)Wheretheprospectiveprimaryparticipantisunabletocertifytoanyofthestatementsinthiscertification,suchprospectiveprimaryparticipantshallattachanexplanationtothisStatementofQualifications.BusinessNamefLL(2DateJCDZZ,By:SignatureofAuthorizedRepresentativeNameandTitleofAuthorizedRepresentative39or921639of87 FORM6FORM6PROPOSER’SQUALIFICATIONSSURVEYCOMPANYQUALIFICATIONSQUESTIONNAIREPleasecompletethisCompanyQualificationsQuestionnaire.BycompletingthisformandsubmittingaresponsetotheRFP,youcertifythatanyandallinformationcontainedintheProposalistrue,thatyourresponsetotheRFPismadewithoutpriorunderstanding,agreement,orconnectionswithanycorporation,firmorpersonsubmittingaresponsetotheRFPforthesamematerials,supplies,equipment,orservices,isinallrespectsfairandwithoutcollusionorfraud,thatyouagreetoabidebyalltermsandconditionsoftheRFP,andcertifythatyouareauthorizedtosignfortheProposer'sfirm.Someresponsesmayrequiretheinclusionofseparateattachments.Separateattachmentsshouldbeasconciseaspossible,whileincludingtherequestedinformation.InnoeventshouldthetotalpagecountofallattachmentstothisFormexceedfive(5)pages.Someinformationmaynotbeapplicable;insuchinstances,pleaseinsert”N/A".FirmNameMO/Wim,MPrincipalBusinessAddressTelephoneNumberFacsimileNumber|nfaPF-j0d66roup,fCEmailAddressFederalI.D.No.orSocialSecurityNumber-72o)13</MunicipalBusinessTax/OccupationalLicenseNo.FIRMHISTORYANDINFORMATIONHowmanyyearshasthefirmhasbeeninbusinessunderitscurrentnameandownership?—?PleaseidentifytheFirm'sdocumentnumberwiththeFloridaDivisionofCorporationsanddatetheFirmregistercd/filedtoconductbusinessintheStateofFlorida:L101^1201^DocumentNumberDateFiledPleaseidentifytheFirm'scategorywiththeFloridaDepartmentofBusinessProfessionalRegulation(DBPR).DBPRlicensenumber,anddatelicensedbyDBPR:CategoryLicenseNo.DateLicensed40of921740of87 PleaseindicatethetypeofentityformoftheFirm(ifother,pleasedescribe):IndividualPartnershipCorporation'^LLCLLPOtherPleaseidentifytheFirm’sprimarybusiness:J(JOITUKI61IPleaseidentifythenumberofcontinuousyearsyourFirmhasperformeditsprimarybusiness:PleaselistallprofessionallicensesandcertificationsheldbytheFirm,itsQualifier/Principal,andanyKeyStaff,includinganyactivecertificationsofsmall,minority,ordisadvantagedbusinessenterprise,andthenameoftheentitythatissuedthelicenseorcertification:License/CertificationTypeNameofEntityIssuingLicenseorCertificationLicenseNo.LicenseIssuanceDate5&EWCbY*!DC«1d(aiIh/Addid.zod-lLP^D'nt\jm.ig<nT\>Pleaseidentifythename,licensenumber,andissuancedateofanypriorcompaniesthatpertaintoLicense/CertificationTypeNameofEntityIssuingLicenseorCertificationLicenseNo.LicenseIssuanceDate11la.Pleaseidentifyallindividualsauthorizedtosignfortheentity,theirtitle,andthethreshold/leveloftheirsigningauthority:AuthorizedSignor'sNameTitleSigningAuthorityThreshold(All,CostuptoSX-Amount.NoCost.Other)anMJ,PleaseidentifythetotalnumberofFirmemployees,managerial/administrativeemployees,andidentifythetotalnumberoftradesemployeesbytrade(e.g.,20electricians,5laborers,2PleaseprovidethefollowinginformationabouttheFirm'sinsurancecompany:InsuranceCarrierNameInsuranceCarrierContactPersonTotalNo.ofEmployees12CTotalNo.ofManagerial/AdministrativeEmployees|OTotalNo.ofTradesEmployeesbyTradeHOcifPnCrS41of921841of.87 _2oKMautvi/lJhmjImpendInsuranceCarrierAddresstelephoneNo,hniail1lastheFirmfiledanyinsuranceclaimsinthelostfive(5}years?0VesIfyes.pleaseidentifythetypeofclaimandtheamountpaidoutundertheclaim:FIRMOWNERSHIPPleaseidentifyalll-imtownersorpartiwra.theirtitle,andnerccntofownership:OwnenT’nrtncrNameiitleOwnership(%)-irnmirrrroW/.r^Cj/.VPleaseidentifywhetheranyoftheowners,’partnersidentifiedabovearcowners/partnersinanotherentity:nNoi(yesIfyes,pleaseidentifythenameoftheowner/partner,theotherentity'sname,andpercentofownershipheldbythestatedowncr/partnet:Owner/PartnerNameOtherEntityNameOwnership<%)1.tfC^,f-Knzirt1t.fco/RECENTQOMRACTSPleaseidentifythefive(5)mostrecentcontractsinwhichyourFirmhasprovidedservicestootherpublicentities:TelephoneNoContactPersonEmailAddressDateAwarded11BmMl.,lWl(foESLkfxiis/jpgxMi'AiwSII„flUQZL/.t/rvafi/l(iaCfWl$OZCQry3mbJWPublicEntityName:ir£is„XSjgB30Qfjar^gni;PCb>c234<iZOL^iZtonCa^LwdcCAIISBysigningbelow,ProposercertifiesthattheinformationcontainedhereiniscompleteandaccuratetnthebestofProposer'sknowledge.Fbm:_J/DOl?LLCAuthorizedSignature:’Uate:U??[2PrintorTypeName:)£PPPTitle:f?f?O'42uf1942<487 FORM7FORM7PRICEPROPOSALPricingshallbesubmittedinaccordancewiththeScopeofServices,Section3.NOTE:OVERTHETERMOFTHEAGREEMENT,THECITYRESERVESTHERIGHTTOADDORDELETESERVICEAREAS,DEPENDINGUPONCONDITIONS.INTHOSECASES,THEANNUALFEEWILLBEADJUSTEDUSINGTHE“SCHEDULEOFVALUES”MATRIXBELOW.A.ANNUALFEEYEARANNUALFEEYear1.HO,2ZO-OOYear2$noYear3s/n,Year4(OptionYear)sM/,/0/.Year5(OptionYear)$/5^<73TOTAL,07^.01B.SCHEDULEOFVALUESFORTHEANNUALFEESylvaMartinandPorch;CityHall(ly&2ndFloor);PoliceDepartment(Is*&2ndFloor)CommunityCenter(Multi-Purpose,Arts&CraftsComputerLab&EducationRoom),DOIndoorBasketballGymnasium/BteachersS0),^3C)OMarshallWilliamsonbuilding.commonlyknownasMobleybuildingsIO,1-3-0-003L43of922043of87 SeniorCitizensCenter,<5,ooPublicWorkssIO,330.00DanteFascellPark$^,0LI-0oo2144of87 FORM8FORM8REFERENCELISTINADDITIONTOTHEINFORMATIONREQUIREDON1HISFORM,PROPOSERSHALLPROVIDEAMINIMUMOFFOUR(4)REFERENCELETTERS.REFERENCE#1PublicEntityName:ROHjCCC/Cl\JO<IH/VIIflIReferenceContactPerson/Title/Department:ContactNumber&EmailClCCl^C'l^i/~)/JWH/Y)ICl-C]QU'PublicEntitySize/NumberofResidents/SquareMileage:/?|QEvent(s)Completed(includeNameofProject/Event,DateofEventStart/Completion,DetailsonSize/ScopeofWork/Complexity)llyCiCCl/ll/y^j•fC'l'T/lfIstheContractstillActive?Yes/of922245487 REFERENCE#2PublicEntityName:.PP^HfClHhReferenceContactPerson/Title/Dcpartmcnt:PercyContactNumber&Email_OLQ-JU)PublicEntitySize/NumberofResidcnts/SquareMileage:Event(s)Completed(includeNameofProject/Evcnt.DateofEventStart/Completion,DetailsonSize/ScopcofWork/Complexity)i/\Zjamionaidivaw/ocYcDcn/ROndaUZfmrtCjW/W/I&fl/f.istheContractstillActive?YesNo46of922346of.81 REFERENCE#3PublicEntityName:jReferenceContactPerson/Title/Dcpartment:C'CYX’AJ(Y1L4fContactNumber&Email^Q4>-/26^3^Cckl^G!200^1^}>orqPublicEntitySize/NumberofRcsidenls/SquarcMileage:nMEvenl(s)Completed(includeNameofProjecVEvcnt.DateofEventStart/Complction.DetailsonSize/ScopeofWorVComplexity).afreeti/UHhdaniTo^cUIstheContractstillActive?YesNo2447of87 REFERENCE#4PublicEntityName:_ReferenceContactPerson/Title/Department:'.Jf7-ContactNumber&EmailOho,ajuaffiz,06bo305-7^-WPublicEntitySize/NumbcrofResidents/SquareMileage:nIqEvcnt(s)Completed(includeNameofProject/Event,DateofEventStart/Completion,DetailsonSize/ScopeofWork/Complexity)/W1^1IQC£(%>■ns^,cOOXc(i^ic^l.IstheContractstillActive?Yes/\No48of922548of87 March28",2023"ToWhomItMayConcern1'IamwritingthislettertorecommendtheservicesofFloridaPreferredGroup.AstheSafetyDirectorforCitrusHealthNetwork,Iunderstandtheessentialroleofjanitorialservicesintheenvironmentofcareinahealthcaresetting.FloridaPreferredGrouphasdeliveredthesecrucialservicestoourfacilitiesduringthepastthreeyears.Iamextremelysatisfiedwiththewaytheyconductbusinessandprovidequalityservices.Theyremaincompliantwithindustrystandards.TheirstaffhavedemonstratedtheirqualificationstoseizethejobregardlessofthechallengeTheadministrativestaffisattentive,dedicated,determinedtoassist,andopentofeedback.IwelcomethisopportunitytopromotetheservicesofFloridaPreferredGroupandinconclusion,andwiththemostcertaintyandwithoutreserve,recommendtheirservices.Kindlyregards,GiselaSuarezInpatientAdministrator/SafetyDirectorCitrusHealthNetwork,Inc.2649of87 14125SW320thStreetHnmrjitrflH,Fl33033Office305.216.3276Fax:305,24635«?Floridn't*lluniqtNtwnFinn!HankJenniferOvesFloridaPreFerrodGroupMarch21,2023WehavebeenusingFlor'duPreferredGroupCleaningservicessinceJuly2020.Theyhavegreatstaffthatisprofessional,punctualandreliableanddoagoodjobcleaningourfacility.Wecanreallyonthemwhenweneedtorescheduleorwhenweneedadditionalservicescompleted.Wcareverypleasedwiththeirservicesandwouldhighlyrecommend.Sincerely,DarleneBinghamFarmShare,IncQuincy*Jadtaunville*Palatka*PainsBeach*Brownnl*Miami-Italic*FloridaCityFannShareHeadijuarterin14125SW320thStreetHamcxtcad,FL33033OHire:305.246.3276lax:30x246.3580~Form*hatf-Mg275C<487 LiVe(it*tCHILDHOODCANCERFOUNDATIONuraouTowhomitmayconcern-OnbehalfofallofusattheLiveLikeBellaChildhoodCancerFoundationIwouldliketoboththankandrecommendFloridaPreferredGroup(FPG).FPGprovidesjanitorialservicesatourheadquartersinCoralGables,FLandtheytakecareofourofficeasofitweretheirownhome.Inaddition,asanon-profitfoundation,weareespeciallygratefulforalltheydonatetousin-kindthroughouttheyear.GettingtotheofficeknowingthatourspacewillalwaysbeimmaculateissuchareliefWehostmeetingsalmostdailyandeveryonewhovisitsalwayscommentsonhownicetheofficelooksandyoucantellit’salwayshandledwithcare.WereallyappreciateeachofthemandlookforwardtocontinuingourrelationshipwithFPGformanyyearstocome!IfIcanprovideanyadditionalinformation,pleasedonothesitatetocontactmedirectlyCordially,NicoledeLaraPuenteChiefExecutiveOfficerLiveLikeBella®ChildhoodCancerFoundationLiveLikeBella®ChildhoodCancerFoundation|wwwLiveLikeBellaorg2199PonceDeLeonBlvd.Ste.303CoralGables,FL33134|(786)505-3914|lnfo@LiveLikeBella.orgTheLiveLikeBella®ChildhoodCancerFoundationiscommittedtobeinganinternationallyrecognizedleaderinchildhoodcancerresearchandadvocacywhileprovidingfinancialandemotionalsupporttofamilieswhosechildrenarebattlingcancer28SialSI NORTH'MIAMIPARKSANDRECREATIONItStartsInParks!January24,2024Re:LetterofRecommendationFloridaPreferredGroupTowhomitmayconcern,FloridaPreferredGroup(FPG)hasbeenworkingwithCityofNorthMiamiParks&RecreationDepartmentforoverayear,duringwhichtime,Ihavegottentoknowtheworkersandleadershipteam;andadmiretheirsenseofdedicationandcommitmenttowardsourcommunity.FPGhasservedasthesolecleaningandjanitorialserviceproviderfortheScottGalvinCommunityCenter.AstheRecreationCoordinator,directlyin-chargeofthefacility,1mostlycommendtheirdependabilityandattentiontodetails.Duringwhichtime,1havelearnedtorelyontheirmaturelevelofresponsibilityandprofessionalism.AsaParksandRecreationProfessional,withover15yearsofexperienceinfacilitymanagementandpublicrelationaffairs,IcanassureyouthatFPGisatop-notchorganization.Youwillnotbedisappointed.Ihighlyrecommend!Shouldyouhaveanyfurtherquestions,pleasefeelfreetocontactmeat:305-895-9840(Office)orviaemailat:agarcia(a)nortluniamifl.govlyGarciaRecreationCoordinatorISOONE125StreetINorthMiamiIFloridaI33181305.805.98402952of87 CDR|MAGUIREToWhomItMayConcern,IamwritingthislettertohighlyrecommendFloridaPreferredGroup(FPG)fortheirexceptionalservicesinmaintainingcleanlinessandsanitationinCDRandancillaryfacilities.FPGhasbeenprovidingservicestoourorganizationsince2022throughoutthestateofFlorida.Inadditiontoourcorporateoffices,FPGhassupportedCDRthroughourHealthandEmergencyManagementdivisionsinactivationsformajordisasters,suchasHurricaneIanandtherecentHurricaneDebby.FPGprovidedjanitorialservicesinAlternateCareSites(temporaryhospitals)andGeneralPopulationSheltersinSouthwestFloridaduringHurricaneIan,andmostrecentlycleaningservicesattheStateEmergencyOperationsCenterinTallahasseeduringHurricaneDebby.Throughoutthistime,theyhaveconsistentlydemonstratedhighlevelsofprofessionalism,reliability,andattentiontodetail.Theirteamofjanitorialstaffisthoroughintheircleaningprocessesandalwaysensuresthatfacilitiesarekeptinpristinecondition.WehavebeenextremelysatisfiedwiththequalityofworkprovidedbyFPG.Theyhaveconsistentlyexceededourexpectationsandhaveshownflexibilityinaccommodatingspecificcleaningneedsandschedules.Additionally,theirresponsivenesstoanyconcernsorspecialrequestshasbeencommendable.IcanconfidentlysaythatFPGhasplayedacrucialroleinhelpingusmaintaincleanandhealthyenvironmentsforourstaff,visitors,andclients.Theirserviceshaveundoubtedlycontributedtotheoverallsuccessofourorganization,andwearegratefulfortheirdedicationandhardwork.IwholeheartedlyrecommendFPGtoanyorganizationseekingreliableandprofessionaljanitorialservices.Theircommitmenttoexcellenceandcustomersatisfactiontrulysetsthemapartfromothercleaningcompanies.Sincerely,JudithL.IvesterBusinessDevelopmentCoordinatorCDRMaguire,Inc.,EmergencyManagementDivision11740SW80thSt-»02MiamiFl.33:83•P7262358534•Fa-786235850twwwcop-companiescom3053<487 northImiamiPARKSANDRECREATIONJanuary26,2024Re:LetterofRecommendationFloridaPreferredGroupTowhomitmayconcern,Iamwritingthislettertohighlyrecommend;FloridaPreferredGroup(FPG)fortheirexceptionalservicesinmaintainingthecleanlinessatourParksandRecreationfacilities.Ihavehadthepleasureofworkingcloselywiththemforoverayearandtheircommitmenttoexcellencehastrulyimpressedme!FPGhasconsistentlydemonstratedathoroughunderstandingoftheuniquecleaningneedsofourfacility(ScottGalvinCommunityCenter).Theirteamisdiligent,reliable,andgoesaboveandbeyondtoensurethatourpremisesarenotonlycleanedbutalsowell-maintained.OneoftheaspectsthatsetsFPGapartistheirattentiontodetail;theyareproactiveinidentifyingareasthatrequirespecialattentionandaddressthempromptly.Theirstaffiswelltrained,professional,andalwaysapproachtheirworkwithapositiveattitude.Itisevidentthattheytakeprideintheirworkandarededicatedtocreatingasafeandhygienicenvironmentforourpatrons.Supervisorsmakeperiodicalvisitsandareontopofourneeds,whichIspeciallyappreciate.Inadditiontotheirexemplarycleaningservices,FPGhasalsobeenresponsivetoanylastminutespecialrequestsorconcernsthatwehaveraised.Theircommitmenttocustomersatisfactionistrulycommendable,anditreflectsinthepositivefeedbackwehavereceivedfromourfacilityusers.Ihighlyrecommend!Shouldyouhaveanyfurtherquestions,pleasefeelfreetocontactmeat:305-895-9840(Office)305-467-3553(Cell)orviaemailat:cramos@norlhmiamifl.gov1600NE126StreetINorthMiamiIFloridaI3316130S.895.98403154of87 FORM9FORM9KEYSTAFF&PROPOSEDSUBCONTRACTORSKEYSTAFFPleasecompletethefollowingchartwiththeFirm’sproposedKeyStaff.Ifadditionalspaceisrequired,pleasecopy/du|licatethispageandattachtothisForm.Additionalspace:NoYesNameTitleYearsofExperienceYearswithFirmLicenscs/CertificationsQurxtiiIP^3PiXclXlCjXiZqnrrralfx203jPleaseexplaintheFirm'sabilityandresourcestosubstitutepersonnelwithequalorhigherqualificationsthantheKeyStafftheywillsubstituteforwheresubstituteisrequiredduetoattrition,turnover,oraspecificrequestbytheCity:(rf.PH(XjnrrQICi^O^rrlirL.JX.tfCXjnnrlCleaningpnDCr0.^X7'.49of923255af87 PleaseidentifyeachKeyStaffmember'sengagementcommitmentsthatwillexistconcurrentlywiththeCity’sServices:KeyStaffNameAreaofResponsibilityClientCommitment(Hours/week)PeriodofEngagementXllMl411Mlrv'bcqqltcirca20PROPOSEDSUBCONTRACTORSTheundersignedProposerherebydesignates,asfollows,allmajorsubcontractorswhomtheyproposetoutilizeforthemajorareasofworkfortheservices.Thebidderisfurthernotifiedthatallsubcontractorsshallbeproperlylicensed,bondable,andshallberequiredtofurnishtheCitywithaCertificateofInsuranceinaccordancewiththecontractgeneralconditions.Failuretofurnishthisinformationshallbegroundsforrejectionofthebidder’sproposal,(ifnosubcontractorsareproposed,state“None"onfirstlinebelow.)SubcontractorName&AddressScopeofWorkLicenseNumberAuthorizedSignature:PrintorTypeName:~TC*.OH1f~ffOVOf-Date:.Title:0x0Firm:_50of923356of57 PROOFOFEXPERIENCEFoundedin2019,ourcompanyspecializesexclusivelyinjanitorialandcommercialcleaningservices,leveragingtheexpertiseofasistermaintenancecompanywithover15yearsofexperienceindeliveringexceptionalservice.Wearefullycommittedtodeliveringhigh-qualitycleaningsolutions,drawingonourextensivebackgroundinservinggovernmentagenciesandorganizationsofsimilarsizeandscope,particularlyinSouthFlorida.Withoveradecadeofexperienceintheindustry,andfiveyearsunderourcurrentbusinessname,wearefullyequippedtomeettheneedsoftheCityandprovidetailoredcleaningservicestosuityourspecifications.Ourteampossessesadeepunderstandingofbusinessoperationsandlegalrequirements,ensuringcomplianceandreliability.Thisincludes:1.CompliancewithLegalandSafetyStandards:oFulladherencetoOSHAregulations,includingbloodbornepathogenprotocolsandworkplacesafetyrequirements.oStrictcompliancewithlocal,state,andfederallaborlawsgoverningemploymentandserviceprovision.oResponsiblehandlinganddisposalofcleaningchemicalsinlinewithenvironmentalregulations.2.ExpertiseinBusinessOperations:oDevelopmentoftailoredcleaningplansthatalignwithmunicipalrequirementsandoperationalschedules.oRobustqualitycontrolprogramswithregularinspections,clientfeedbackmechanisms,andperformanceassessments.oEfficientresourceallocationandschedulingtomaintainuninterruptedserviceduringpeakusageorspecialevents.3.TrainingandCertification:oStafftrainedinindustrybestpractices,advancedcleaningtechnologies,andcustomerserviceprotocols.oCertificationsineco-friendlyandsustainablecleaningpracticestoreduceenvironmentalimpact.Thefollowingattachmentsoutlineourbusinessoperationsandprocedures.3457487 HORANGEQCInspectionSoftware:FPGusesaQualityControlSoftwarenamed“OrangeQC”.ProgramObjectives:•Ensurethatallemployeeshavetheknowledgetoperformtheirjob•Ensurethatallemployeesarefollowingcompanyprotocolandobeyingbythecleaningtasks•ImprovedteamworkThissoftwareallowstheFPGQualityControlOfficerto:•Performroutineinspectionsrightfromhistablet•Monitoraccountperformances&sendrealtimealertsbasedontriggersyouset•GeneratereportsforclientsHowitworks:Ifanything,otherthana“Satisfactory”isentered,thesystemwillprovideareportsuggestingactionstobetaken.Theenduseristo:A.RefertoasupervisorB.ImmediateActionRequiredC.HighRisk(hazardoussituationstohealthorsafety)Thereportwillshowallsatisfactoryareasandthatareinneedofattention.Aticketisthenissuedtothesupervisorand/ormanagerincharge.Theyareresponsibletocommunicateacopyofthereporttothecleanerssothattheyareabletoaddressallconcernsandcleartheticketwithin48hours.FPG’sHiringProceduresE-Verifyprotectsjobsforauthorizedworkersandhelpsemployersmaintainalegalworkforce.KeyBenefitsofusingtheE-Verifysysteminclude:•Helpingemployeesmaintainalegalworkforce•VirtuallyeliminatingSocialSecurity•ImprovingtheaccuracyofwageandtaxreportingFPGrunsbackgroundchecksforallemployees.IbisOrganizationParticipatesinE-Verify\3558of87t-VerUyWsrkaforEwrywiotnt-Wirvf* Backgroundchecksinclude:-CriminalHistorySearchViolentSexualOffenderRegistrySearchDMVRecordsFloridaHRSAbuseRegistryFPGusesatimetrackingapplicationnamed“ADP”.ProgramObjectives:ADPisoneofthebiggestprovidersofhumanresources(HR)softwaresolutionsandoutsourcedservicesintheworldofferingservicessuchas:•Payrollandtax•HRmanagement•Timeandlabor•BenefitsMobileTimeTrackingApp-GEOlocationsADPLogsemployeeclockin/outtimesbasedonaperimeter/boundaryaroundaparticularlocationonamap.MICROFIBERTECHNOLOGY:IGlassCleaningRedRestroomCleaningBlueGeneralCleaning3659of87 SAFETYCOMPLIANCE&SDSDOCUMENTATION:IncompliancewithOSHAsafetyregulations,FloridaPreferredGroupensuresthatacomprehensiveSafetyDataSheet(SDS)bookismaintainedineveryjanitorialclosetateachservicedfacility.ThisSDSbookcontainsdetailedinformationaboutallcleaningproductsusedon-site,includingtheirproperhandling,storage,andemergencyprocedures.KUOUNIFORM:FPGisawareofthevalueanappropriatelyrecognizedemployeecanaddtoaworkplace.Forthisreason,FPGoffersprofessionalandidentifiableuniform.Housekeepersweargreypoloshirtswithourlogoplainlyvisibleinthefront.FPGalsoprovidesanidentificationcardtoeveryemployeethatisrequiredtocarrywiththematalltimesduringworkhours.FPGisawareoftheneedofhavingallworkersidentified.Wewanttomakesurethatyourguestsfeelsecureandarealwaysawareofwhoisworkingnearby.EMPLOYEEID’s:JenniferOvesPresidentEmployeeID:198637GO81 OneofthegovernmentagencieswehavehadthehonorofservicingisScottGalvin,CityofNorthMiami.Below,weprovideadetailedinspectionofourworkatScottGalvin,highlightingourproventrackrecordandcommitmenttoexcellence:I*#11897470JANITORIALINSPECTIONlocation:SCOTTGALVIN(NORTHMIAMI)inspectorYaimaRamayoCompleted202412-2611:44amScore:9S%HondaPreferredGroupLineItemENTRANCES4LOBBYAREAENTRANCESLLOBBYAREAENTRANCESRatingAboveAverageI.Theglassoftheentrancesdoorslooksclean,nohandsorfingersmarkswerefound.2.AutomaticDoorstrackslookclean,nodebriswasfound3.1hetrashconattheentrancelooksdeanandisempty4.Doorsframesarebeingpropertycleaned,nostainswerefound5.Evententrancedoorsarepropertycleaned4Mainentrancenospiderwebswerefound.5.SideentranceIsbeingpropertycleaned.LOBBYAREA:1.Floorsarebeingcleanedproperty2.Sweptandmoppedcorrectly3.tinderthechairslookclean,nodebrisardustwasfound4.Behindreceptiondeskirdeon5Halfwaycomersandedgesarepropertycleaned6.Lobbyareabehindtheplantslookclean,nodeberswasfound.7.Receptiondeskisclean.8.Waitmgareaisbeingcleanedproperty9.Underthebenchareclean,dustfree10.froshandrecyclingcontainersarecleanandemptyPHOTOSATTACHED.Score95*ioLineitemRating16ituScoreKITCHENAREA&BREAKROOM;PKITCHENAREAt.BREAKROOM:1Floorsaresweptandmoppedcorrectly.2Chairsandtableareclean.3Tableandchairsarebeingpropertycleaned.4.Nomarkswerefoundinthecabinetdoors.5Topofrefrigeratorhavenodust6.Stainlesssteelsinktookcleanandshine7Countertoplookclean.8Nodebrisfoundunderthetable.9.Trashcontainerisclean.10.Behindthetrashcontainerisclean.11Thetopoftheinformationboardisdean.PHOTOSATTACHED.AboveAverageISVItje¬ll22219$*2«28NM21LineitemCARPETSAFLOORS:CARPETSRating1.Entrancesblackrugarebeingpropertyvacuumed.2.Conferenceroomarebeingdeonedandmaintainedcorrectly3.Officecarpetispropertymaintained.4.Behindtheofficedoorsareclean,freeofdustFLOORS.1.Lobbyareaarebeingsweptandmoppedproperty.2.Firstfloorhaltwayslookclean,comersandedgesdustfree3.Secondfloorelevatorlobbyisclean.4.SecondandThirdfloorhallwaysarebeingpropertymaintained,havenodust5.Bathroomsfloorareclean.6.Secondfloorbehindreceptiondeskfloororeclean.7.Comersandedgesnodebriswasfound.&Elevatorfloorsoreclean.9.Gymfloorsareclean.PHOTOSATTACHED.A/CVENTS4VENTILATIONGRILLAboveAverageScoreBASEBOARDS4WALLSAboveAverage95% PREVIOUSPROJECTS1.CDRHealth•ScopeofWork:CleaningoffacilitiesandofficeslocatedinDoral,TampaandTallahassee,Florida.•SpecialEngagement:WorkedcollaborativelyduringHurricaneMilton(October2024-November2024),providingcleaningreliefinsheltersinSt.Petersburg,Jacksonville,Tampa,WesleyChapel,andAuburndale.•ContractPeriod:August2024-Present•ClientContact:JacqulinePerez,305-336-5650-jacqueline.perez@cdrmaguire.com•ProofofCompletion:AttachedQualityControl(QC)cleaningreportsforDoralandTallahasseeoffices.CDRDORAL:^#11941472JANITORIALINSPECTIONLocation:CDRHEALTH(DORAL)Inspector:YatmaRamayoCompleted:2025-01-033:14pmScore:96%FloridaPreferredGroupLineItemENTRANCESALOBBYAREA:PENTRANCESiLOBBYAREARatingAboveAverageENTRANCES1Thetrashcansareemptieddaily2.Entrancefreeofspiderwebs.3.Nodebriswasfound.4Glassdoorsarepropertycleaned,nohandsmarkswerefoundLOBBYAREALRootbpropertycleanedarebeingsweptandmoppedcorrectly2.Underthechairsnodebriswasfound3Receptiondesksurfacestookdean4.WaitingareaschairsarebeingpropertydeanedandorganizedS.Carpetsarepropertyvacuumed6.Secondfloor(Suitee11i12)receptiondeskssurfacesarepropertydeaned.PhotosattachedScore95%PCARPETSAROORSCARPETSAboveAverageLWaitingareascarpetsorebeingpropertyvacuumed2.Eramroomsarevacuumeddotty3Officesbehindthedoorsaredean.4Hallwayscarpetsarevacuumedcorrectly5.Restroomscarpetisdean.ROORS1Sweptandmoppedpropertyontabfloor2Kitchenflooranbeingpropertymaintained,nodebrawasfound.3Restroomsfloorslookdean,comersandedgesfreeofdebnsPhotosattached3962c/87 LbwItemRatinenm•10010110210310*IM107IMIMnoBASEBOARDS&WALLS:AboveAveragePBASEBOARDS£WALLS:BASEBOARDS:IfontandSecondHoothallwaysbaseboardsanbringcleanedproperty2.ColumnsbaseboardshavenodusL3Waitingareas(firstandsecondfloor/behindthechainbaseboardsaredean.4Managersofficeshavenodust5FirstandSecondfloorsexamroomsdustfree6Behindthedoorsdustfree7.Kitchenbaseboardsoreclean.ARestroomsbaseboardsarecleanWALLS:1.Examroomswolfsbehindtrashconsaredean2Hallwayswallslookdean,finsomeareasstainswerefoundbuttheydonotcomeout).3Labispropertycleaned4Hostainswerefoundintheexamroomswalls5.Wallsbehindthedoorsatepropertycleaned.6Secondfloorelevatorlobbywallsarebeingcleanedproperty,nostainswerefound.7KitchenwallslookgoodandcleanARestroomswallsoredeanPhotosattached.inininminELEVATORS'AboveAveragePELEVATORS1Elevatortrackslookdean,nodebnswasfound2Floorispropertycleaned,sweptandmappedcorrectly3Interiordoorpropertycleaned4.bghtfixturesdustfree5.Handrailadean&Wallslookdean,nomarkswerefoundPhotosattached.9S%UI1«lt«io*IM4063of87 CDRTALLAHASSEE:#11550947JANITORIALINSPECTIONLocation:CORHEALTH(TALLAHASSEE)ImpedonYamaRamayoGxnplered:2024-10-121043pmScore:95%RondaPreferredGroupUneItemENTRANCESALOBBYAREA:QENTRANCES&1068YRatineAboveAverageICarpetisroaiumedandcleanedpropertyZGlassdoorstockdean,arepropertydecned,nohandsmarkswerefound3Wocobwetriwerefound4Theentrancensvrept5Entrancesvdewolkstookgoodanddean,tOBBrAREAIfloorsarebernqweptandmoppedproperty2Comersandedgestookgoodanddean3AHsurfacesorebeingpropertydenned4.Kogconetableiscleanandorganized.5Deskandchairsorecleananddustfree6Couchesaredeanandorganized7Underthecouchesnodebmerasfound&Receptiondeskadean9Chamtegslookgoodanddean,dustfreePhotosattachedScore95%UnaItemlaHIOKHENAREAABREAKROOM:0«TCHEWA®AtBREAKROOMLflooradean,svreptandmoppedproperty2.Topolrefngerotocisdean,havenodust3.Underthetobies,nodebnsworfound4Countertoplookgoodandclean5.Underthesmksaredeemedproperty6Sinksorebeingpropertycleaned7.Whitecabrnetsdoorsartdean,nohandsmariafoundINodebrisvrosfoundbehindthetrashcan.9.Trashcantookaredeanandempty10.Comersandedgesnodebnsrrasfound.HMcrvMWrudean.AboveAveragePhotosattached.More95%LOWANOHIGHOUSTING•AboveAverage4164of87 RMi>CRESTROOMS(LADtESAHOMEN'SBATHROOMSJPLADIESANOMENSBATHROOMSIfoiMpoaendapemefdustfree2HandroJartdean1Mirrorsnowatermoriawerefound4.SnEltoo*goodanddean1Countertoporepropertydeoned.SBehindthetoiletsnodebmwoifoundZloiletsarepropertydeemed*Paperstowelsdrsperaercardeanandpropertyrefitted9Cornersandedgeslookdean,nodebmwmfound10SweptandmappedcorrectlyILlodesbasenostainswerefound.12froshcancoveradean.Photosattachedhboeefmctgelt>mIM110EMERGENCYSTAIRWELLSC>£M£fKXKCYSTMWUS1UAboveAve*egeIHospu/enrebswerefound2Stepsorebcmgpropertycleaned3Hondtodtaredeon,nohcndjmariafoundELEVATORS:AboveAve**jePELEVATORS1Elevatortnxktookgoodanddeannodebmwasfound2.flooriibemgsweptandmoppedproperty3Handrailaredean,nostainswerefound4.Buttonspaneltookcleanandshw>e.nohandsmari.1werefound5.Stanleusteelwallsanpropertycleaned&Lrtenorandmtenorstamleusteeldaanorepropertydeoned.N/AOFFICES/CLASSROOMS&CONFERENCEROOMAboveAveragePOFFICES/CLASSROOMS/TRAININGROOMANDLABOFFICES:1.Arepropertyvacuumed.2.Deskaredean.3.Chainleasnoduttwasfound.4.BehindmecomputersthereisnodustCLASSROOMS/TRAININGROOMLCarpetarepropertyvacuumed.2.Chairsaredeanandorganized3.NofingermarkswerefoundonthetableLABS1.FloorsSweptandmoppedcorrectly2.Stainlesssteeltablesarepropertycleaned3Sinkorepropertycleaned4.CountertoplookcleanS.Cabinetsdoorsarepropertycleaned6.Examtablesarebeingpropertycleaned,nodustwasfound7.ExamsmomsequipmentshavenodustPhotosattachedScore65of87 2.DoodieCalls•ScopeofWork:EmergencyjanitorialservicesforareasaffectedbyHurricanesDebby,Milton,andHelene,providingcleanupinemergency-affectedregionsacrossthestateofFlorida.•ContractPeriod:August2024-January2025.•ClientContact:JackieGross,941-233-4673-jackie@doodie-calls.com•ProofofCompletion:Documentationofemergencyresponseserviceengagementsandrelevantcleaningreportsforimpactedareas.DOODIECALLSEmergencyServicesRestroomCleaning-Stop3Friday,January10,202510IssuesIdentified4366of87 3.Lexus/Toyota•ScopeofWork:Ongoingdailycleaningservicesforalldepartmentsduringbusinesshours(Sales,Service,etc.)at8locations,includingKendallToyota,LexusofKendall,ToyotaofWestKendallandLexusofWestKendall.•ContractPeriod:OngoingsinceAugust2020..•ClientContact:JohnAlvarez,305-778-4064-john.alvarez@beanauto.com•ProofofCompletion:AttachedQualityControl(QC)reportsfordailyservices,confirmingconsistentservicedeliveryandclientsatisfaction.LEXUSWESTSERVICE:R»11852355JANITORIALINSPECTIONLocation:LEXUSWEST(SERVICE)InspectorYaimaRamayoCompleted:2024-12-131:54pmScore:9WFloridaPreferredCroupLineItemENTRANCEStLOBBYAREA:QENTRANCESALOBBYAREAENTRANCES:1Entrancesnodebriswosfound,lookdean.ZNobandsmarkswerefoundonglassdoorsentrances.3Nospiderwebswerefound.4NodebriswasfoundondoorstracksSNastainswerefoundonaluminumdoorsframes.LOBBYAREA:AboveAverage1.SweptandmoppedpropertyZCoffeetablesarebeingpropertycleaned.3Leathercouchesoredeanandorganized4UndercouchesnodebtafoundSComersandedgesnodustfound&CustomerservicedesksurfacedustfreePhotosattachedKITCHENAREA&BREAKROOMAboveAverage95*QKITCHENAREA;BREAKROOMACOFFEESTATIONKITCHENAREA/BREAKROOMN/ACOFFEESTATION1TopofcoffeemachinearecleanZNoHandsmarkswerefoundoncabinetdoors.3Countertoppropertycleaned.PhotosattachedLOWANDRICHDUSTING:QLOWANDHIGHOUSTINGLPartsaccessoriesshelvesaredean,nodustwosfoundZExtsigns,nodustwasfound.3.NodustfoundonArealarms.4.ATMmachineisdustfree.5.Firealarms,nodustwasfound6Topofcoffeemachinedustfree.TWaterfountainisbeingpropertycleanedaBehindTVlookclean,nodustwasfound9.MogaoneStands,havenodust10SmalttablearebeingpropertycleanedPhotosattachedExceptional10O*4467^87 CARPETSAFLOORS:C>CARPETS&FLOORSCARPETSLMeentranceblockmatureproperlyvacuumedZBlockrugcoffeestationanbeingvacuumedpropertyJEntrancesrugwithlogoarebeingpropertyvacuumed.FLOORSIPartsacKesaoneslookclean.ZCustomerservicedaksweptordmoppedcormtfyJ.Entrancespropertycleaned4CustomererortmgareaorebeingcleantdpropertySUnderthecouchesnodebriswasfound.6Internetaccessispropertymaintained,dustfree7KidzonecomersandedgeslookdeanPhotosattachedException*!WOWLineItemA/CVENTSAVENTILATIONGRILL:PM?VENTSiVENT1LAT1ONGRILLICoffeestationventsartdean,nodustfound2InternetaccessA/Cventshavenodust3Restroomsventsnodustwasfound4KidzonelookgoodandpropertycleanedPhotosattached.WINDOWSILLStBUNDS:RatingAboveAverageAboveAverageScore9SWC>WINDOWSILLSABLINDS1ExteriorwindowsiUsarebeingpropertydeaned2.Windowsiltsbehindtheleathercoucheshavenodust.3.K>dzonealuminumwtndowsdlsaredean,nodustfound.4.Customerwaibngareaupperwindowsillstookgoodanddean,hovenodust5.Waitingareablindsarepropertymaintained,nodustfound.&Emptyofficesdustfree.Photosattached.BASEBOARDS&WALLS:^BASEBOARDSIWAUSBASEBOARDSAboveAverageLNodustfoundonKidtonebaseboardsZInternetaccessroomsorcdean1PortAccessoiresareabaseboardsaredean.4Kidzonedustfree.5UnderstainlesssteelwaterfountainbaseboardshavenodusLWALLSISMLMzoneisdean,somettnmjdontcomeouL2Internetaccessroomsmanystainshare,don'tcomeoff1Nexttocoffeestationwalloredean.4.Restroomswallslookdean,nohandsmothswerefoundPhotosattached.68of87 RESTROOMS(LADIESANOMEN'SBATHROOMS)EaceptionalPRES/ROOMS(LUXESA//0MINSBATHROOMS)IComersandedgesnodebrhfoundZSweptandmoppedcorrectlyICountertopsnoftomtmerefound.4largetrnrronarebeingpropertymaintained5.Behindthetoiletsadean6FnlrobasenostainswerefoundT.HondraibhavenodustaSuitalookclean,theyarepropertymaintained9toiletpaperdispenserdaafreeandproperlyrehlfed10.Topofrcsboomsportibomdustfree.11Stalklookoften,nobandsmerfowerefound12Changingtabletarebeingpropertycleaned,notrainsfound13Whitepipesundertheunknonavedust14Theportiboraaredustfree15Urmlpartrboruarepropertycleaned!€Noyellowstainswasfoundundertheunnais,lookverycleanWon10OHPhotosattachedeKt:aU4U»<MUI1UIMERGENCYSTAIRWELLS:PemekencysmnmfusN/A.ELEVATORS:QUTVATOIISN/APARKINGLOTAGARAGE:QPARIOMIOTAGMMCNJAOFFICES/CLASSROOMS&CONFERENCEROOMAboveAverageAboveAverageAboveAverageAboveAverage»5*9V.LineItemPOFTTCES/CMSSROOHStCONF£R£HCEROOMOfnCESN/AOASSROaVSNJACONFtRENCEfiOWN/AtarzoNEIKidronelookclean2TVAsplayarepropertycleaned,hovenodust3.Thetableandchoirsaredean.4ComersandedgesnodebrnwasfoundSRoonoresweptandmoppedcorrectlyPhotosattachedCOUHENTSN/ASUGGESTIONSSUGCESTTONS:N/AQUALITYCONTROL6SAFETYMANAGER^OWliTYCONTROLASVETYMANAGERTAIMARAHAYO4669of87 PROPOSER’SQUALIFICATIONSJENNIFERFRANCOOVESProjectManager3806SW148thAve,Miami,FL33185•(786)838-8029•JenniferOvesl9@gmail.comPROFESSIONALEXPERIENCEMrs.Oveshasover21yearsofadministrativeandmanagementexperienceintheprivatesectorthatincludessupervising,planningandcoordinating.WhileMrs.Ovesisabletoapplypriorknowledgeandsocialskillsthroughoutthecompany.ShehasprovenherselfbygrowingthecompanytoprovideservicesthroughoutthestateofFloridaandGeorgia.Sheispresentinhercompanyandhasclearcommunicationwithherteam.Sheimplementsnewtechniquestohelptheteamworkefficientlyandisopentochangeswhenneeded.Ms.Ovesworeallthehatswhenthecompanywasfirstopened,whichmadeherfullyawareofthedifferentrolesperformedthroughoutthecompany.CEO&FounderFloridaPreferredGroup2020-current•Managingateamof100+individuals•RecruitingandOnboarding•Trainingandcoordinatingcontinuingeducation•Overseeingalloperationsandensuringthattheteamisexecutingallrequirements•Allpayrollfunctions•Accountspayableandreceivables•Schedulingsitevisits•Initialclientinterview•Preparingcontractsandcustomizedcleaningschedules•Allsocialmediaplatforms•EmergencyManagementServicesLeadAdministrativeAssistant/ParalegalLawOfficesofCorredor,Husseini&Snedaker,P.A.,Miami,FL,2005-2020Activelysupportingateamofattorneyswithlitigationandrealestateexperience.Responsibleformanagingahighvolumeofcivillitigationcases•Managingcalendarfor5attorneysincluding2partners•Filingandmaintainingofpersonalinjurylawsuits•Supervisingtheassistantstoconfirmtheyareworkingefficientlyandeffectively•Conductingcalendarmeetingsonceamonth•Schedulingandconfirmingalloperationsincludingdepositions,hearings,mediations,independentmedicalexaminationsandexaminationunderoaths•Preparationofcorrespondence,affidavits,motionsandpleadings•Negotiationandsettlementofcases4770of.87 •Reviewofcasestoprovideclientswiththestatusandclosingfiles•Managingofficesuppliesinventorycontrol•OrganizingeventssuchasChristmasParty,RealEstatemeetingsandAnnualAnniversaryFunctions(Includinghotelbooking,cruiseplanningandorganizingtours)•Preparingchecksanddisbursingpaymentstoclientsandvendors•Schedulinginterviewsandassistingwiththehiringprocess•CoordinatingtravelarrangementforattorneysPart-TimeTravelConsultantExquisiteVacations,Inc2013-2015•Assistingcustomerswiththeirtravelneeds•Handlingofcallsandrespondingaccordingly•Makingreservationsforhotels,flights,cruisesandcarrentals•Coordinatingandnegotiatingwithtourplannersregardingrates,timeanddate•PreparinginvoicesandprocessingpaymentsEDUCATIONMiamiDadeCollege,Miami,FLBachelorofAppliedScienceinSupervisionandManagementDec2014AssociateofArts2010UniversityofMiami,Miami,FLParalegalCertificateJune2009StateofFloridaNotaryPublicKEYSKILLS•MicrosoftWord(Excel,Outlook,PowerPoint),AdobeAcrobat,TimeMatters,ADPRUN,ADPWorkforce,OrangeQC,Quickbooks,LexisNexisandWestLaw•FluentinEnglishandSpanishFdabFTRAINING’CERTIFICATEOFCOMPLETIONThiscertifiesthatJenniferOvesisawardedthiscertificateforOSHA10HourOutreachTrainingProgram-GeneralIndustryCreliHxinmnCcn^*ticnO*eP)1000gy,04/26/2020anOSHAauthorizedtrair«r.fythatIha.,eoMvcttdthaOSHAo.treachIranngdaninaceordancerathOSH*OureachTranngProgramr»gurm»r«.I*•!docu-runtW,eauiomyautnchiingOSHAtra.ninqc'garizationUccnrr.'ea<<mydc<'.n^rtrior.ivrilcfCvl*eachwvdetntrrrtyno<*:.cricard,vith.-i99da,ao'theerwotth*da«'ri'isccfinncAjeishsu-nuNSfEmsteKOIHCate-*OfTermHw,,BldgI,StK*2(01Attain.f»78731I8773EI2235t»-aa,JCCtrairingcren48714x7 SERVICEANDINCORPORATIONStateofFloridaDepartmentofStateIcertifyfromtherecordsofthisofficethatFLORIDAPREFERREDGROUP,LLCisalimitedliabilitycompanyorganizedunderthelawsoftheStateofFlorida,filedonOctober29,2019,effectiveOctober28,2019.ThedocumentnumberofthislimitedliabilitycompanyisL19000270086IfurthercertifythatsaidlimitedliabilitycompanyhaspaidallfeesduethisofficethroughDecember31,2024,thatitsmostrecentannualreportwasfiledonJanuary29,2024,andthatitsstatusisactive.GivenundermyhandandtheGreatSealoftheStateofFloridaatTallahassee,theCapital,thistheTwenty-ninthdayofJanuary,2024TrackingNumber:74S7202979CCToauthenticatethiscertificate,visitthefollowingsite^nterthisnumber,andthenfollowtheinstructionsdisplayed.https://servicesjunbiz.org/Filings/CertificateOiStatus/CertificateAnthentication4912a/S7 ElectronicArticlesofOrganizationForFloridaLimitedLiabilityCompanyArticleIThenameoftheLimitedLiabilityCompanyis:FLORIDAPREFERREDGROUP,LLCL19000270086FILED8:00AMOctober29.2019Sec.OfStarejsdennisArticleIIThestreetaddressoftheprincipalofficeoftheLimitedLiabilityCompanyis:2449SW153PASSMIAMI.FL.33185ThemailingaddressoftheLimitedLiabilityCompanyis:2449SW153PASSMIAMI,FL.33185ArticleIIIThenameandFloridastreetaddressoftheregisteredagentis:JENNIFEROVES2499SW153PASSMIAMI,FL.33185Havingbeennamedasregisteredagentandtoacceptserviceofprocessfortheabovestatedlimitedliabilitycompanyattheplacedesignatedinthiscertificate,Iherebyaccepttheappointmentasregisteredagentandagreetoactinthiscapacity.Ifurtheragreetocomplywiththeprovisionsofallstatutesrelatingtotheproperandcompleteperformanceofmyduties,andIamfamiliarwithandaccepttheobligationsofmypositionasregisteredagent.RegisteredAgentSignature:JENNIFEROVES5073<^S7 ArticleIVThenameandaddressofpersonas)authorizedtomanageLLC:Title:MGRLICETTEARODRIGUEZP.O.BOX771566MIAMI.FL.33177L19000270086FILED8:00AMOctober29.2019Sec.OfStatejsdennisArticleVTheeffectivedateforthisLimitedLiabilityCompanyshallbe:10282019SignatureofmemberoranauthorizedrepresentativeElectronicSignature:JENNIFEROVESIamthememberorauthorizedrepresentativesubmittingtheseArticlesofOrganizationandaffirmthatthefactsstatedhereinaretnie.IamawarethatfalseinformationsubmittedinadocumenttotheDepartmentofStateconstitutesathirddegreefelonyasprovidedforins.817.155.F.S.IunderstandtherequirementtofileanatuiualreportbetweenJanuary1standMay1stinthecalendaryearfollowingfonnationoftheLLCandeven'yearthereaftertomaintain"active"status.5174of87 LICENSES7293134SEC.TYPEOFBUSINESS213SERVICEBUSINESSEmpioyee(s)1RECEIPTNO.RENEWAL7582551OWNERFLORIDAPREFERREDGROUPLLCC/OJENNIFEROVES,MGRBUSINESSNAME/LOCATIONFLORIDAPREFERREDGROUPLLCOPERATINGINDADECOUNTYPAYMENTRECEIVEDBYTAXCOLLECTOR75.0007/16/2024INT-24-433658LocalBusinessTaxReceiptMiami-DadeCounty,StateofFlorida-THISISNOTABILL-DONOTPAYLBTEXPIRESSEPTEMBER30,2025MustbedisplayedstplaceofbusinessPursuanttoCountyCodeChapter8A-Art.9&10HrAMWAPE,ThislocalBusinessTaxReceiptonlyconfirmspaymentofthelocalBusinessTax.TheReceiptisnotelicense,permit,oracertificationoftheholder'squalifications,todobueinees.Holdermustcomplywithanygovernmentalornongovernmentalregulatorytawsandrequirementswhichapplytothebusiness.TheRECEIPTNO.abovemustbedisplayedonallcommercialvehicles-Miami-DadeCodeSecta-Z76.Formoreinformation,visitwww.mianiidaile.tiav/laxconectnr5275of57 FLORIDAPREFERREDGROUP,LLCunuannul»mumjishb•SUPFUacnQOPMOTIscertifiedundertheprovisionsof287and295.187.HondaStatutes,foraperiodfrom.08/29/202308/29/2025PedroAllendeFlondaDepartmentofManagementServicesOWk«ofSupplierDevelopment4030EtpUnedeWey,Swto380Tanaha>M«.Florid.32399830-487'0913wxw.dmi.myflorid..com/oidBetterBusinessBureau*ServingSoutheastFloridaandtheCaribbeanBBBACCREDITEDBUSINESSFloridaPreferredGroup,LLCValidThroughJuly2025ThisorganizationhasdemonstratedthatitmeetsBBBStandardsofTrustandcommitstoupholdthemission,servcesandstandardsofethicalbusinesspracticesneededforBBBAccreditation.5376of87 PERSONNELQUALIFICATIONS/KEYSTAFFFORM9KEYSTAFF&PROPOSEDSUBCONTRACTORSKEYSTAFFPleasecompletethefollowingchartwiththeFirm’sproposedKeyStaff.Ifadditionalspaceisrequired,pleasecopy/duplicatethispageandattachtothisForm.Additionalspace:nNooYesNameTitleYearsofExperienceYearswithFirmLicenses/CcrtificationsWcTy4193pvrcirCiquiz.qnrrrrA^^Y(CC203PleaseexplaintheFirm’sabilityandresourcestosubstitutepersonnelwithequalorhigherqualificationsthantheKeyStafftheywillsubstituteforwheresubstituteisrequiredduetoattrition,turnover,oraspecificrequestbytheCity:whMotrri2VrmpiogrryQ-f.mio-fjnrrmpfo^rJrftih-iylinj-rifr-tynnciCi-eanmcj49of925477<4HI PleaseidentifyeachKeyStaffmember’sengagementcommitmentsthatwillexistconcurrentlywiththeCity’sServices:KeyStaffNameAreaofResponsibilityClientCommitment(Hours/week)PeriodofEngagementAd3^Coniccuteim^cjcr620PROPOSEDSUBCONTRACTORSTheundersignedProposerherebydesignates,asfollows,allmajorsubcontractorswhomtheyproposetoutilizeforthemajorareasofworkfortheservices.Thebidderisfurthernotifiedthatallsubcontractorsshallbeproperlylicensed,bondable,andshallberequiredtofurnishtheCitywithaCertificateofInsuranceinaccordancewiththecontractgeneralconditions.Failuretofurnishthisinformationshallbegroundsforrejectionofthebidder'sproposal.(Ifnosubcontractorsarcproposed,state“None"onfirstlinebelow.)SubcontractorName&AddressScopeofWorkLicenseNumberAuthorizedSignature:((yxS7">PrintorTypeName:"JC(f~fCOUQC•Date:[faMrTitle;OOPFirm:HlVldAHXC(6ftUp,LLC50ot925578487 YaimaRamayoRosabel2001SW67thAvenueApt542Miami,FL33155(786)881-3604Yaimaramayo2003@qmail.comEXPERIENCES2013-2022Managerofhotelandcateringservicesasocialmedicalestablishment2018ManagerofhousekeepingatresidencefortheelderlyfoundationlesBruydres2018ManagerofhousekeepingatresidencefortheelderlyfoundationlesChStaigniers2018ManagerofhousekeepingathotelBeauRivage2012HousekeeperatEspacedeVieHousekeeperatResidenceforelderlydeDrize2009-2012HousekeeperatHoteld’Angleterre2008HousekeeperatSADAAKAH2007HousekeeperathotelLaCigogne2007HousekeeperathotelCrownPlazaGenevaTRAINING2018Professionalpracticetrainingcertificate(AFP)2018Certificateoffirewitness2020Stewardshipmanager.Federalcertificateofcapacity2017CertificateofCleaningandarrangementofpremisesandequipment2019CertificateExecutionofadministrativework2019Selfhealthpromotionandclientsupport2016CertificateofErgomotricity2019Standardprecautions:protectingyourselfandothers2022WorkplaceSafetyandHealthCertificationsIssuedbyOSHA•HazardCommunication(EmergencyActionPlan)•BloodbornePathogens•FireSafety•Ergonomics•ElectricalSafety•Slip,Trip,andFallPrevention•HandHygiene•HeatStress•PersonalProtectiveEquipment(PPE)•WorkplaceSafety•CarbonMonoxideAwareness5679<4S7 MGMINDRAGUIZGONZALEZmindry68(Sfcmail.com7862441760Hialeah,Florida33014SUMMARYSKILLS.Motivationalleaderandorganizationalproblem-solverwithadvancedsupervisory,teambuildingandcustomerserviceskills.Experiencesteppingintorolesandquicklymakingpositivechangestodrivecompanysuccess.Focusedonusingtraining,monitoringandmorale-buildingtechniquestomaximizeemployeeengagementandperformance.TalentedHumanResourcesManagerdriventoaddresspolicyimplantationandchangemanagementwithcreativeandinnovativeapproach.Strongunderstandingofevolvingindustryandmakerdemands.Offers7yearsofexpertiseinbenefitsadministration,compensationstructuringandrecruitment.•OnboardingandOrientation.•TechnicalProficiency.•RecruitmentandSelection.•ThainingandDevelopment.•CostControl•PerformanceTrackingandEvaluation.•ManagingOperationsandEfficiency.•HiringandThaining•TeamBuilding.•BudgetManagement.•EmployeeCoachingandMotivation.•PerformanceEvaluations.•ProjectPlanning.•ComplexProblemSolving.•GoalSetting.•DocumentationandReporting.•SchedulingandCoordinating.•VerbalandWrittenCommunication.•EmployeeDevelopment.•TeamLeadership.BusinessDevelopment.•ShiftScheduling.•DecisionMaking.•MSOffice.•ComputerSkills.•TimeManagement.•Inter-DepartmentCollaboration.•HumanResourcesManagement.•CalmunderPressure.•StrategicPlanning.•InterpersonalRelations.•BusinessAnalysisandReporting.•ProfessionalandCourteous.•CustomerRelationshipManagement.•P&LOversight.•NegotiationandConflictResolution.•CustomerService.•NativeSpanish.•IntermediateEnglishlanguage.•AdvanceCatalanlanguage.Alliservice(Florida,UnitedState)09/2021Manager5780of87 ORGANIZATIONALCHART5881of87 INSURANCECERTIFICATESACORD*CERTIFICATEOFLIABILITYINSURANCETHISCERTIFICATEISISSUEDASAMATTEROFINFORMATIONONLYANDCONFERSNORIGHTSUPONTHECERTIFICATEHOLDER.THISCERTIFICATEDOESNOTAFFIRMATIVELYORNEGATIVELYAMEND,EXTENDORALTERTHECOVERAGEAFFORDEDBYTHEPOLICIESBELOW.THISCERTIFICATEOFINSURANCEDOESNOTCONSTITUTEACONTRACTBETWEENTHEISSUINGINSURER(S),AUTHORIZEDREPRESENTATIVEORPRODUCER,ANDTHECERTIFICATEHOLDER.IMPORTANT:IfthecertificateholderIsanADDITIONALINSURED,thepohcy(ies)musthaveADDITIONALINSUREDprovisionsorbeendorsed,ifSUBROGATIONISWAIVED,subjecttothetermsandconditionsofthepolicy,certainpoliciesmayrequireanendorsement.Astatementonthiscertificatedoesnotconferrightstothecertificateholderinlieuofsuchendorsement(s).PRODUCERRealInsuranceAgencyCorp1400SW67AvecontactWlk.cNAME:MIKE(305)2648536Sc.H.1(305)264-6732addressMichael.femandez026@gmaii.comMiamiFL33144INSURERS)AFFORDINGCOVERAGEINSURERAKINSALEINSURANCECONAIC#INSUREDFLORIDAPREFERREDGROUPLLC3806SW148AVEMiamiFL33185INSURERB:INSURERC:INSURERD:""INSURERE:INSURERF:COVERAGESCERTIFICATENUMBER:REVISIONNUMBER:THISISTOCERTIFYTHATTHEPOLICIESOFINSURANCELISTEDBELOWHAVEBEENISSUEDTOTHEINSUREDNAMEDABOVEFORTHEPOLICYPERIODINDICATED.NOTWITHSTANDINGANYREQUIREMENT,TERMORCONDITIONOFANYCONTRACTOROTHERDOCUMENTWITHRESPECTTOWHICHTHISCERTIFICATEMAYBEISSUEDORMAYPERTAIN,THEINSURANCEAFFORDEDBYTHEPOLICIESDESCRIBEDHEREINISSUBJECTTOALLTHETERMS,EXCLUSIONSANDCONDITIONSOFSUCHPOLICIES.LIMITSSHOWNMAYHAVEBEENREDUCEDBYPAIDCLAIMS.DESCRIPTIONOFOPERATIONS/LOCATIONS/VEHICLES(ACORD101.AdditionalRamarksSchedule,maybeattachedIfmorespacelarequired)INSRLTRTYPEOFINSURANCEADDLSUBRINSDWVDPOLICYNUMBERPOLICYEFF(MM/DD/YYYY)POLICYEXP(MM/DD/YYYY)LIMITSAXCOMMERCIALGENERALLIABILITYYY0100253620-0108/09/202408/09/2025EACHOCCURRENCE$1,000,000|CLA1MS-MADEXOCCURDAMAGETORENTEDPREMISES(Eaoccurrence)$100,000MEDEXP(Anyoneperson)$5,000PERSONAL&ADVINJURY$1,000,000GEWLAGGREGATELIMITAPPLIESPER:GENERALAGGREGATE$2,000,000POLICY|X|JECT|_XIOTHERPRODUCTS-COMP/OPAGG$2,000,000$AUTOMOBILELIABILITYCOMBINEDSINGLELIMIT(Eaaccident)$ANYAUTOBODILYINJURY(Perperson)$OWNEDAUTOSONLYHIREDAUTOSONLYSCHEDULEDAUTOSNON-OWNEDAUTOSONLYBODILYINJURY(Peraccident)$PROPERTYDAMAGE(Peraccident)$$UMBRELLAL1ABEXCESSLIAS—OCCURCLAIMS-MADEEACHOCCURRENCE$AGGREGATE$DEO|IRETENTIONS$WORKERSCOMPENSATIONANDEMPLOYERS'LIABILITYy,NANYPROPRIETOR/PARTNER/EXECUTIVEOFFICER/MEMBEREXCLUDED?(MandatoryInNH)Ifyes,describeunderDESCRIPTIONOFOPERATIONSbelowNIAPERIOTH-ISTATUTE|ERE.LEACHACCIDENTsE.L.DISEASE-EAEMPLOYEE$ELDISEASE-POLICYLIMITJJANITORIALSERVICESCERTIFICATEHOLDERISLISTEDASADDITIONALINSURED.CERTIFICATEHOLDERCANCELLATIONCITYOFSOUTHMIAMI6130SunsetDriveSouthMiami,Florida33143ACORD25(2016/03)SHOULDANYOFTHEABOVEDESCRIBEDPOLICIESBECANCELLEDBEFORETHEEXPIRATIONDATETHEREOF.NOTICEWILLBEDELIVEREDINACCORDANCEWITHTHEPOLICYPROVISIONS.AUTHORIZEDREPRESENTATIVE©1988-2015ACORDCORPORATION.Allrightsreserved.TheACORDnameandlogoareregisteredmarksofACORD5982^81 ACORdCERTIFICATEOFLIABILITYINSURANCECOVERAGESCERTIFICATENUMBER:4080110REVISIONNUMBER:CERTIFICATEHOLDERCANCELLATIONACORD25(2016/03)DATE(HWDDfYYYY)01/21/2025©1988-2015ACORDCORPORATION.Allrightsreserved.TheACORDnameandlogoareregisteredmarksofACORDTHISCERTIFICATEISISSUEDASAMATTEROFINFORMATIONONLYANDCONFERSNORIGHTSUPONTHECERTIFICATEHOLDER.THISCERTIFICATEDOESNOTAFFIRMATIVELYORNEGATIVELYAMEND,EXTENDORALTERTHECOVERAGEAFFORDEDBYTHEPOLICIESBELOW.THISCERTIFICATEOFINSURANCEDOESNOTCONSTITUTEACONTRACTBETWEENTHEISSUINGINSURER(S),AUTHORIZEDREPRESENTATIVEORPRODUCER,ANDTHECERTIFICATEHOLDER.IMPORTANT:tfthecertificateholderisanADDITIONALINSURED,thepolicy(ies)musthaveADDITIONALINSUREDprovisionsorbeendorsed.IfSUBROGATIONISWAIVED,subjecttothetermsandconditionsofthepolicy,certainpoliciesmayrequireanendorsement.Astatementonthiscertificatedoesnotconferrightstothecertificateholderinlieuofsuchendorsement(s).PRODUCERAutomaticDataProcessingInsuranceAgency.Inc.1AdpBoulevardRoselandNJ07068INSUREDRocidaPreferredGroupLLC3806SW146thAveMamiFL33185AutomaticDataProcess.ngInsuranceAgency.Inc.KcSo.Exfr1-800-524-7024[^.HoFE-MAILADDRESS'MSURERfS)AFFORDINGCOVERAGENAIC8Whirera:TechnologytnsurarxeCOTpany.Inc42378INSURERB:INSURERC:INSURERINSURERE:INSURERFnINCE.MIRLTR4ISISTOCERTIFYTHATTHEPOLICIESOFINSURANCELISTEDBELOWHAVEBEENISSUEDTOTHEINSUREDNAMEDABOVEFORTHEPOLICYPERIODDICATEDNOTWITHSTANDINGANYREQUIREMENT,TERMORCONDITIONOFANYCONTRACTOROTHERDOCUMENTWITHRESPECTTOWHICHTHISERTIFICATEMAYBEISSUEDORMAYPERTAINTHEINSURANCEAFFORDEDBYTHEPOLICIESDESCRIBEDHEREINISSUBJECTTOALLTHETERMS.KCLUSIONSANDCONDITIONSOFSUCHPOLICESLIMITSSHOWNMAYHAVEBEENREDUCEDBYPAIDCLAIMS.TYPEOFINSURANCEWjPWWPOLICYNUMB®(MWoSyYYY)(MWDDffYyY)LIMITSCOMMERCIALGENERALUABiUTYEACHOCCURRENCESOAJZAGETDRENTEDCLAIMS-MADEOCCURPREMISES(Eaoccurrence)SMEDEXP(Anyoneperson)SPERSONAL&ADVINJURY5GENLAGGREGATEUMfTAPPLIESPERGENERALAGGREGATE5POLICYJECTLOCPRODUCTS-COMP:OPAGG5OTHER:1AUTOMOBILEUABIUTYANYAUTOOWNEDSCHEDULED.AUTOSONLYAUTOSHIREDNCN-OWNEDAUTOSONLYAUTOSONLYCOMBINEDSINGLELIMIT«(Eaaccident)*BODILYIJUURY(Perperson)SBODILYINJURY(Peracddeni)$PROPSTTYDAMAGE<(Peraccident)*SUMBRELLAL1ABOCCUR_EXCESSUABCLA1MS4/ADEDEDRETENTIONSEACHOCCURRENCESAGGREGATESSAWORKHiSCOMPENSATIONANDEMPLOYERS'LIABILITYytMANYPROPRETOR.PARTNERi'EXECUTIVEOFHCER.WENBEREXCLUDED?।NIMandatorytnnhinyes,CtesorfteunderDESCRIPTIONOrOPERATIONSbelowPEROTH-/\STATUTEERH/ANTWC441796DD5/11/202405/11/2025EACHACCIDENTS1.000.000ELDISEASE-EAEMPLOYEES1.000,000ELDISEASE*POLICYLiMT51.000,000DESCRIPTIONOFOPERATIONSILOCATIONSIVEHICLES(ACORD101.AdditionalRsnwMSciadute.maybesttacfiedifmoreapacelarequired)CityofSouthMiami6130SunsetDriveSHOULDANYOFTHEABOVEDESCRIBEDPOLICIESBECANCELLEDBEFORETHEEXPIRATIONDATETHEREOF.NOTICEWILLBEDELIVEREDINACCORDANCEWITHTHEPOLICYPROVISIONS.AUTHORIZEDRB’RESENTATTVESouthMiamiFL331436083of87 ACORDCERTIFICATEOFLIABILITYINSURANCEthiscertificatedoesnotconfertothecertificateholderinlieuofsuchDATE{MMlDOWYYY)01/22/2025THISCERTIFICATEISISSUEDA8AMATTEROFINFORMATIONONLYANDCONFERSNORIGHTSUPONTHECERTIFICATEHOLDER.THISCERTIFICATEDOESNOTAFFIRMATIVELYORNEGATIVELYAMEND,EXTENDORALTERTHECOVERAGEAFFORDEDBYTHEPOLICIESBELOW.THISCERTIFICATEOFINSURANCEDOESNOTCONSTITUTEACONTRACTBETWEENTHEISSUINGINSURERfS),AUTHORIZEDREPRESENTATIVEORPRODUCER,ANDTHECERTIFICATEHOLDER.IMPORTANT:IfthocertificateholderisanADDITIONALINSURED,thepollcy(foa)musthaveADDITIONALINSUREDprovisionsorbeendorsed.IfSUBROGATIONISWAIVED,subjecttothotermsandconditionsofthopolicy,certainpoliciesmayrequireanendorsementAstatementonPRODUCERProgressiveInsurancePOBox94739.Cleveland.OH44101CONTACTNAME:ProgressiveCommercialLinesCustomerandAoentSenAdnoPHONEFAX(AIC,No.Exfl:1-000-444-4407(A/C.NekADDRESS:pmgfBBsiveconYnenialgemMl.proQresstve.comINSURER^}AFFORDINGCOVERAGEHAICfINSURERa:ProgressiveExpressInsuranceCompany10193INSUREDFloridaPreferredGroup3808Sw146ThAveMiami.FL33185INSURERB:INSURERC:INSURERD:INSURER:INSURERF:COVERAGESCERTIFICATENUMBER:588149589301997S050012225T152S20REVISIONNUMBER:THISISTOCERTIFYTHATTHEPOLICIESOFINSURANCELISTEDBELOWHAVEBEENISSUEDTOTHEINSUREDNAMEDABOVEFORTHEPOLICYPERIODINDICATED.NOTWITHSTANDINGANYREQUIREMENT.TERMORCONDITIONOFANYCONTRACTOROTHERDOCUMENTWITHRESPECTTOWHICHTHISCERTIFICATEMAYBEISSUEDORMAYPERTAIN.THEINSURANCEAFFORDEDBYTHEPOLICIESDESCRIBEDHEREINISSUBJECTTOALLTHETERMS.EXCLUSIONSANDCONDITIONSOFSUCHPOLICIESLIMITSSHOWNMAYHAVEBEENREDUCEDBYPAIDCLAIMS.DESCRIPTIONOFOPERATH)NS/LOCATIONSIVEHICLES(ACORD101.AddHtoralRomariaScboduto,mayboattachedHmaaspace1»required}INSRLTRTYPEOFINSURANCEADOLNSDSUBRWVDPOLICYNUMBERPOLICYEFFMM'DO/YYYY)POLICYEXP(MWDO/YYYY)LilinsCOMMERCIALGENERALLIABILITY|OCCUREACHOCCURRENCEtCLAJM3-MADEDAMAGETURtNILbPREMISES(Ea9<wn»r«X»)$MEDEXP(Anyoneparxen)*PERSONAL&ADVINJURYGENERALAGGREGATEI—rPRO-POLICY|JECTL_LOCOTHER:PRODUCTS*COMPiOPAGGs$AAUTOMOBILELIABILITYNN96326896511/000024HI0W202SCOMBINEDSINGLELIMIT(E*noaident)1—ANYAUTOBODILYINJURY{Perparson)$100,009xBODILYINJURY(Perwxirienl)$300,000Xfi^OMLY$60,000$UMORELIAUA0EXCESSL1ABOCCURCLAIMS-MADEEACHOCCURRENCE$AGGREGATE$D£D1RETENTIONS$wcAMRKERSCOMPENSATIONW1MnFMPiovpoifiiammrymNIAl^mxlIK*ANYPROPfUETORPARTNEWEXECUTIVEII05F1CER/MEMBEREXCLUDED?IIEl.EACHACCIDENT$El.DISEASE*EAEMPLOYEEOAxmmwjrInNH)Byea.describeunoarDESCRIPTIONOFOPERATIONSbelow$ElDISEASE•POLICYLIMIT$ASeeACORD101fareddtfandcoreragedeiaSs.HN06326896511X19120241109^028$CERTIFICATEHOLDERCANCELLATIONCitycfSoOhMiamiCityHall6130SunsetDriveMlani.FL33143SHOULDANYOFTHEABOVEDESCRIBEDPOLICIESBECANCELLEDBEFORETHEEXPIRATIONDATETHEREOF.NOTICEWILLBEDELIVEREDINACCORDANCEWITHTHEPOLICYPROVISIONS.AUTHORIZEDREPRESENTATIVEACORD25(2016/03)©1988*2015ACORDCORPORATION.Allrightsreserved.TheACORDnameandlogoareregisteredmarksofACORD6184487 ACORD1ADDITIONALREMARKSSCHEDULEPage1of1FORMTITLE:CertificateofLiabilityInsuranceFORMNUMBER:25$100000/3300,000Liabilitycoveragemaynoiapplytoaltscheduledvehicles.ACORD101(2008/01)AGENCYCUSTOMERID:LOC8:©2008ACORDCORPORATION.Allrightsreserved.TheACORDnameandlogoareregisteredmarksofACORDLimits$10,000w/$0Ded-NamedinsuredOnlyADDITIONALREMARKSTHISADDITIONALREMARKSFORMISASCHEDULETOACORDFORM.AdditionalCoveragesInsuranceeovorago(s)PersonaInjuryPrelectionUnnsuredMotors!-NonslackedAGENCYProgressivaInsuranceNAMEDINSUREDFloridaPreferredGoxe>3808Sw148ThAveMiami.FL33185POLICYNUMBERsea2dddd5CARRIERProgressiveExpressInsuranceCompanyNAICCODE10103EFFECTIVEDATE:11/09/20246285<487 EXHIBIT“C”RATESCHEDULECityofSouthMiami86of87Exhibit“C” FloridaPreferredGroupP:(786)643-6853www.FloridPreferredGroup.comYear1-$42,682.50Year2-$44,816.63Year3-$47,057.46Year4-$49,410.33Year5-$51,880.8481of«7 Tabulation Sheet Agency Name City of South Miami Bid Number RFP-(RFP) No. FN2024-17-0-2024/SK Bid Name JANITORIAL SERVICES Bid Due Date 01/23/2025 10:00:00 Eastern Bid Opening Closed 21 responses found.online, offline, not submitting, not received Company Responded Address Bid Amount Alt Bid Amount Declared Attributes Documents Sent Complete 1 .Able Business Services, Inc. 01/23/2025 09:56:14 Eastern 1234 NW 79 Street, Miami, FL, 33147 $452500.0000 0.0000 African American Owned, Small Business Bidding Document 2 .Amer-Plus Janitorial Maintenance LLC 01/23/2025 09:57:07 Eastern 1265 NE 203rd ST, Miami, FL, 33179 $1370259.2000 0.0000 Bidding Document 3 .Boss pro Cleaning Solutions, LLC 01/23/2025 09:29:43 Eastern P.O BOX 89154, Tampa, FL, 33689 $286651.3300 26977.8700 Bidding Document 4 .Chi-Ada Corpororation 01/22/2025 23:12:45 Eastern 4820 West Commercial Blvd, Tamarac, FL, 33319 $755635.1200 0.0000 Bidding Document 5 .CLEAN SPACE INC. 01/22/2025 12:58:25 Eastern 3764 NW 124th Avenue, Coral Springs, FL, 33065 $0.0000 0.0000 Bidding Document 6 .Comet Cleaning Systems Inc 01/22/2025 21:06:16 Eastern 1773 N State RD 7, 101I, Lauderhill, FL, 33313 $140530.0000 0.0000 Bidding Document 7 .Complete Contract Consulting 01/23/2025 09:56:19 Eastern 7306 S Saint Patrick Street, Tampa, FL, 33616 $496989.1200 0.0000 Bidding Document 8 .DVE Capital Group LLC 01/23/2025 00:11:43 Eastern 19790 W. Dixie Hwy Suite, SUITE 1101, Miami, FL, 33180 $137274.0000 0.0000 Bidding Document 9 .ELLA'S PROPERTY SERVICES LLC. 01/23/2025 04:23:42 Eastern 160 YACHT CLUB WAY 203, HYPOLUXO, FL, 33462 $95000.0000 97000.0000 Bidding Document 10 .Florida Preferred Group, LLC 01/22/2025 16:41:26 Eastern 3806 sw 148th ave, Miami, FL, 33185 $9240.0000 0.0000 Bidding Document 11 .Goodwill Industries of South Florida, Inc. 01/23/2025 09:25:20 Eastern 2121 NW 21 Street, Miami, FL, 33142 $224886.8900 0.0000 Bidding Document 12 .Green Facility, Inc 01/23/2025 09:23:59 Eastern 8530 NW 47TH ST, Coral Springs, FL, 33067 $237837.3000 0.0000 Asian/Hawaiian Owned Bidding Document 13 .High Maintenance Services 01/23/2025 00:44:17 Eastern 4380 SW 74th Avenue, $491311.0000 281833.5000 Bidding Document 1 of 39 241 z 1 z z 1 z 1 z z 1 z 1 z z 1 z z 1 Miami, FL, 33155 14 .Kleen-Tech Services, LLC 01/22/2025 13:29:51 Eastern 7100 Broadway, Suite 6L, Denver, CO, 80221 $490856.0000 0.0000 Bidding Document 15 .Klen Space Inc. 01/23/2025 09:36:14 Eastern 4555 Shearwater Lane, Naples, FL, 34119 $129917.3300 0.0000 Bidding Document 16 .Marsden Services 01/22/2025 20:06:16 Eastern 1388 SW 8th St., Pompano Beach, FL, 33069 $89286.0000 0.0000 Bidding Document 17 .MCJ & Professional Cleaning Services 01/22/2025 17:04:23 Eastern 1905 NW 32ND STREET, SUITE 6, Pompano Beach, FL, 33064 $1094342.7800 0.0000 Bidding Document 18 .National Cleaning Contractors USA Inc 01/22/2025 16:08:20 Eastern 14482 SW 38 Lane, Miami, FL, 33175 $121218.7500 0.0000 Bidding Document 19 .SFM Janitorial Services, LLC. 01/23/2025 09:06:31 Eastern 7500 NW 74 Avenue, Medley, FL, 33166 $136226.0000 0.0000 Bidding Document 20 .Unlimited Cleaning Company, LLC 01/23/2025 09:26:02 Eastern 4560 west 9 ct, Hialeah, FL, 33012 $565132.0000 0.0000 Bidding Document 21 .Wgmaintenance 01/22/2025 16:47:17 Eastern 3550 Galt Ocean Dr , fort lauderdale , FL, 38880 $179390.0000 0.0000 African American Owned, Small Business Bidding Document 2 of 39 242 3 of 39 243 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services,Section 3. NOTE:OVER THE TERM OF THE AGREEMENT,THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS,DEPENDING UPON CONDITIONS.IN THOSE CASES,THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES”MATRIX BELOW. A.ANNUAL FEE YEAR ANNUAL FEE Year 1 s ^POf]— Year 2 /—$?z zoo — Year 3 Year 4 (Option Year)s 9*/yoo Year 5 (Option Year) t s ^Q.OOO — TOTAL / B.SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch;City Hall (1st &2nd Floor);Police Department (1st & 2nd Floor)S /0,^0 — Community Center (Multi-Purpose, Arts &Crafts Computer Lab & Education Room)S ObO — Indoor Basketball Gymnasium/Bleachers s — Marshall Williamson building, commonly known as Mobley building $ 43 of 92 4 of 39 244 Senior Citizens Center S Public Works $3 7^^ Dante Fasceli Park $ Firm: Authorized Signature: Print or Type Name: 44 of 92 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services, Section 3. NOTE: OVER THE TERM OF THE AGREEMENT, THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS, DEPENDING UPON CONDITIONS. IN THOSE CASES, THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES” MATRIX BELOW. A. ANNUAL FEE YEAR ANNUAL FEE Year 1 $ Year 2 $ Year 3 $ Year 4 (Option Year) $ Year 5 (Option Year) $ TOTAL $ B. SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch; City Hall (1st & 2nd Floor); Police Department (1st & 2nd Floor) $ Community Center (Multi-Purpose, Arts & Crafts Computer Lab & Education Room) $ Indoor Basketball Gymnasium/Bleachers $ Marshall Williamson building, commonly known as Mobley building $______________________ 43 of 92 5 of 39 245 Senior Citizens Center $ Public Works $ Dante Fascell Park $______________________ Firm: Authorized Signature: Date: Print or Type Name: Title: 44 of 92 Amer Plus Janitorial Maintenance LLC Stephannie Cetoute Managing Director 01/23/2025 6 of 39 246 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services, Section 3. NOTE: OVER THE TERM OF THE AGREEMENT, THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS, DEPENDING UPON CONDITIONS. IN THOSE CASES, THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES” MATRIX BELOW. A. ANNUAL FEE YEAR ANNUAL FEE Year 1 $ Year 2 $ Year 3 $ Year 4 (Option Year) $ Year 5 (Option Year) $ TOTAL $ B. SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch; City Hall (1st & 2nd Floor); Police Department (1st & 2nd Floor) $ Community Center (Multi-Purpose, Arts & Crafts Computer Lab & Education Room) $ Indoor Basketball Gymnasium/Bleachers $ Marshall Williamson building, commonly known as Mobley building $______________________ 43 of 92 286,651.33 297,899.93 305,489.47 314,289.04 321,288.63 1, 525, 618.40 6435.86 4689.37 2657.69 3134.49 7 of 39 247 Senior Citizens Center $ Public Works $ Dante Fascell Park $______________________ Firm: Authorized Signature: Date: Print or Type Name: Title: 44 of 92 1254.37 1541.23 1289.59 Boss Pro Cleaning Solution LLC Hegel Boss COO January 22nd, 2025 BOSS PRO CLEANING SOLUTIONS LLC 8 of 39 248 & Page 21 of 63 Form 7. Price Proposal Form. 9 of 39 249 South'rMiami THE C*ITY OF PLEASANT I IVING Chi-Ada Corporation’s Response to the City of South Miami’s to RFP No:FN2024- 17,Titled;“Janitorial Services”. FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services,Section 3. NOTE:OVER THE TERM OF THE AGREEMENT,THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS,DEPENDING UPON CONDITIONS.IN THOSE CASES,THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES”MATRIX BELOW. A.ANNUAL FEE YEAR ANNUAL FEE Year 1 $129,078.36 Year 2 $141,986.21 Year 3 $153,345.11 Year 4 (Option Year)$165,612.72 Year 5 (Option Year)$165,612.72 TOTAL $755,635.12 B.SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch;City Hall (lsl &2nd Floor);Police Department (I51 &2nd Floor)$47,071.2 Community Center (Multi-Purpose, Arts &Crafts Computer Lab & Education Room)$39 267 6 Indoor Basketball Gymnasium/Bleachers $15,710.88 Marshall Williamson building, commonly known as Mobley building $15,048.48 43 of 92 Page 22 of 63 10 of 39 250 Chi-Ada Corporation’s Response to the City of South Miami’s to RFP No:FN2024- 17,Titled;“Janitorial Services”. Senior Citizens Center $4,532.64 $ Public Works $2,893.92 $ Dante Fascell Park $4,553.64 Firm:Chi-Ada Corporation Authorized Signature: Print or Type Name:Georges Idani Date:01/21/2025 Title:General Manager 44 of 92 11 of 39 251 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services,Section 3. NOTE:OVER THE TERM OF THE AGREEMENT,THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS,DEPENDING UPON CONDITIONS.IN THOSE CASES,THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES”MATRIX BELOW. A.ANNUAL FEE YEAR ANNUAL FEE Year 1 $140,530 Year 2 $144,746 Year 3 $149,088 Year 4 (Option Year)S 153,560 Year 5 (Option Year)s 158,167 TOTAL $746,091 B.SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch;City Hall (1st &2nd Floor);Police Department (1st & 2nd Floor)$48,880 Community Center (Multi-Purpose, Arts &Crafts Computer Lab & Education Room)$ 36,660 Indoor Basketball Gyninasium/Bleachers $18,330 Marshall Williamson building, commonlv known as Mobley building $ 18,330 43 of 92 12 of 39 252 Senior Citizens Center $6110 Public Works $6110 1 )ante Fascell Park $6110 VICES INC. Authorized Signature: ALPHA BUILDING MAINTEFinn: Print or Type Name:Wayne Baxtrom Date:_1/22/2025 Title:General Manager 44 of 92 A. ANNUAL FEE YEAR ANNUAL FEE Year 1 $137,274.28 Year 2 $144,137.99 Year 3 $151,344.90 Year 4 (Option Year)$158,912.14 Year 5 (Option Year)$166,857.74 Total B. SCHEDULE OF VALUES FOR THE ANNUAL FEE (Year 1) Sylva Martin and Porch; City Hall (1st & 2nd Floor); Police Department (1st& 2nd Floor)$25,167 Community Center (Multi-Purpose, Arts & Crafts Computer Lab & Education Room)$42,824 Indoor Basketball Gymnasium/Bleachers $31,007 Marshall Williamson building, commonly known as Mobley building $23,671 Senior Citizens Center $9,530 Public Works $2,490 Dante Fascell Park $2,586 C. SCHEDULE VALUES YEARLY FACILITY YEAR 1 YEAR 2 YEAR 3 YEAR 4 (OPTION)YEAR 5 (OPTION) Sylva Martin and Porch; City Hall (1st & 2nd Floor)$16,929 $17,776 $18,665 $19,598 $20,578 Police Department (1st & 2nd Floor)$8,237 $8,649 $9,082 $9,536 $10,013 Community Center $42,824 $44,965 $47,213 $49,574 $52,053 Indoor Basketball Gymnasium/Bleachers $31,007 $32,557 $34,185 $35,894 $37,689 Marshall Williamson (Mobley) Building $23,671 $24,854 $26,097 $27,402 $28,772 Senior Citizens Center $9,530 $10,007 $10,507 $11,033 $11,584 Public Works $2,490 $2,614 $2,745 $2,882 $3,026 Dante Fascell Park $2,586 $2,715 $2,851 $2,993 $3,143 Total $137,274 $144,138 $151,345 $158,912 $166,858 1913 of 39 253 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services, Section 3. NOTE: OVER THE TERM OF THE AGREEMENT, THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS, DEPENDING UPON CONDITIONS. IN THOSE CASES, THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES” MATRIX BELOW. A. ANNUAL FEE YEAR ANNUAL FEE Year 1 $ Year 2 $ Year 3 $ Year 4 (Option Year) $ Year 5 (Option Year) $ TOTAL $ B. SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch; City Hall (1st & 2nd Floor); Police Department (1st & 2nd Floor) $ Community Center (Multi-Purpose, Arts & Crafts Computer Lab & Education Room) $ Indoor Basketball Gymnasium/Bleachers $ Marshall Williamson building, commonly known as Mobley building $______________________ 43 of 92 95,000 95,000 95,000 97,000 97,000 479,000 35,000 15,000 18,000 8,000 14 of 39 254 Senior Citizens Center $ Public Works $ Dante Fascell Park $______________________ Firm: Authorized Signature: Date: Print or Type Name: Title: 44 of 92 10,000 6,000 3,000 Ella’s Property Services LLC Pamella Queiroga 23 january 2025 President 15 of 39 255 FORM 7 20 16 of 39 256 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services,Section 3. NOTE:OVER THE TERM OF THE AGREEMENT,THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS,DEPENDING UPON CONDITIONS.IN THOSE CASES,THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES”MATRIX BELOW. A.ANNUAL FEE YEAR ANNUAL FEE Year 1 s HO,2?0.0G Year 2 $UQ .20^ Year 3 $I n.i/>3Q.scl^. Year 4 (Option Year)S M/,IGI-^S Year 5 (Option Year)s TOTAL £,031.012L B.SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch;City Hall (1st &2nd Floor);Police Department (1st & 2nd Floor)s Community Center (Multi-Purpose, Arts &Crafts Computer Lab & Education Room)$DO Indoor Basketball Gymnasium/Bleachers $5,OO Marshall Williamson building, commonly known as Mobley building $IO,330 00 43 of 92 21 17 of 39 257 Senior Citizens Center $HO®00 Public Works $IO, Dante Fascell Park $&,Ol+O.OQ Authorized Signature: Print or Type Name:_ Date:. Title: AtT-rm?6ro»p,llc 44 of 92 18 of 39 258 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services,Section 3. NOTE:OVER THE TERM OF THE AGREEMENT,THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS,DEPENDING UPON CONDITIONS.IN THOSE CASES,THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES”MATRIX BELOW. A.ANNUAL FEE YEAR ANNUAL FEE Year 1 $$224,886.89 Year 2 $$233,882.36 Year 3 $ $243,237.66 Year 4 (Option Year)$$252,967.16 Year 5 (Option Year)$ $263,085.85 TOTAL $ $1,218,059.95 B.SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch;City Hall (1st &2nd Floor);Police Department (1st & 2nd Floor)$ $65,568.60 Community Center (Multi-Purpose, Arts &Crafts Computer Lab & Education Room)$ $44,377.65 Indoor Basketball Gymnasium/Bleachers $ $26,279.62 Marshall Williamson building, commonly known as Mobley building $ $27,526.68 43 of 92 19 of 39 259 Senior Citizens Center $$3,220.56 Public Works $ $53,522.88 Dante Fascell Park $ $1,924.56 Goodwill Industries South FloridaFirm: Authorized Signature: Print or Type Name:Jocelyne Moussavou Title:VP of Service Contracts Date:^2/2025 44 of 92 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services, Section 3. NOTE: OVER THE TERM OF THE AGREEMENT, THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS, DEPENDING UPON CONDITIONS. IN THOSE CASES, THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES” MATRIX BELOW. A. ANNUAL FEE YEAR ANNUAL FEE Year 1 $ Year 2 $ Year 3 $ Year 4 (Option Year) $ Year 5 (Option Year) $ TOTAL $ B. SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch; City Hall (1st & 2nd Floor); Police Department (1st & 2nd Floor) $ Community Center (Multi-Purpose, Arts & Crafts Computer Lab & Education Room) $ Indoor Basketball Gymnasium/Bleachers $ Marshall Williamson building, commonly known as Mobley building $______________________ 43 of 92 $237,837.30 $237,837.30 $244,972.42 $720,647.02 47,951.01 54,754.17 32,577.21 34,355.61 20 of 39 260 Senior Citizens Center $ Public Works $ Dante Fascell Park $______________________ Firm: Authorized Signature: Date: Print or Type Name: Title: 44 of 92 Green Facility Inc. RYAN FLORES 12/20/2024 Client Relationship Manager 24,006.57 22,526.13 21,666.57 21 of 39 261 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services, Section 3. NOTE: OVER THE TERM OF THE AGREEMENT, THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS, DEPENDING UPON CONDITIONS. IN THOSE CASES, THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES” MATRIX BELOW. A. ANNUAL FEE YEAR ANNUAL FEE Year 1 $ Year 2 $ Year 3 $ Year 4 (Option Year) $ Year 5 (Option Year) $ TOTAL $ B. SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch; City Hall (1st & 2nd Floor); Police Department (1st & 2nd Floor) $ Community Center (Multi-Purpose, Arts & Crafts Computer Lab & Education Room) $ Indoor Basketball Gymnasium/Bleachers $ Marshall Williamson building, commonly known as Mobley building $______________________ 43 of 92 89,400.00 93,870.00 98,563.50 103,491.67 $105,986.00 491,311.17 18,249 sqf 22,610 sqf 8394 sqf 9534 sqf 25,084.72 30,975.70 11,499.78 13,061.58 22 of 39 262 Senior Citizens Center $ Public Works $ Dante Fascell Park $______________________ Firm: Authorized Signature: Date: Print or Type Name: Title: 44 of 92 2900 sqf 1951 sqf 1400 sqf 3973.00 2,672.87 1,918.00 J.Perez Enterprises, Inc. D/B/A High Maintenance Services 01/22/2025 JUAN PEREZ PRESIDENT 23 of 39 263 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services, Section 3. NOTE: OVER THE TERM OF THE AGREEMENT, THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS, DEPENDING UPON CONDITIONS. IN THOSE CASES, THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES” MATRIX BELOW. A. ANNUAL FEE YEAR ANNUAL FEE Year 1 $ Year 2 $ Year 3 $ Year 4 (Option Year) $ Year 5 (Option Year) $ TOTAL $ B. SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch; City Hall (1st & 2nd Floor); Police Department (1st & 2nd Floor) $ Community Center (Multi-Purpose, Arts & Crafts Computer Lab & Education Room) $ Indoor Basketball Gymnasium/Bleachers $ Marshall Williamson building, commonly known as Mobley building $______________________ 43 of 92 172,425.31 96,964.49 64,875.99 44,295.33 496,989.12 496,989.12 521,838.58 521,838.58 537,493.74 2,575,149.14 24 of 39 264 Senior Citizens Center $ Public Works $ Dante Fascell Park $______________________ Firm: Authorized Signature: Date: Print or Type Name: Title: 44 of 92 $ 21,854.21 86,290.66 10,283.37 J&B Construction Services Inc Jacques Joseph January 15th, 2025 Vice President 25 of 39 265 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 19 OF 43 26 of 39 266 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services,Section 3. NOTE:OVER THE TERM OF THE AGREEMENT,THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS,DEPENDING UPON CONDITIONS.IN THOSE CASES,THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES”MATRIX BELOW. A.ANNUAL FEE YEAR ANNUAL FEE Year 1 $155,704 Year 2 $163,489 Year 3 $171,663 Year 4 (Option Year)$180,246 Year 5 (Option Year)$189.258 TOTAL $860,360 B.SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch;City Hall (1st &2nd Floor);Police Department (1st & 2nd Floor) Year 1:$31,079 Year 2:$32,633 Year 3:$34,265 Year 4:$35,978 $Year 5:$37,777 Community Center (Multi-Purpose, Arts &Crafts Computer Lab & Education Room) Year 1:$52,284 Year 2:$54,898 Year 3:$57,643 Year 4:$60,525 $Year 5:$63,551 Indoor Basketball Gymnasium /Bleachers Year 1:$20,370 Year 4:$23,581 Year 2:$21,389 Year 5:$24,760 $Year 3:$22,458 Marshall Williamson building, commonly known as Mobley building Year 1:$21,817 Year 4:$25,256 Year 2:$22,907 Year 5:$26,519 $Year 3:$24,053 KLEEN-TECH 43 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 20 OF 43 27 of 39 267 Docusign Envelope ID:1BBE81A0-8587-48C8-8E14-3D5149BEF529 Senior Citizens Center Year 1:$11,582 Year 4:$13,407 Year 2:$12,161 Year 5:$14,077 $Year 3:$12,769 Public Works Year 1:$9,617 Year 4:$1 1.133 Year 2:$10,098 Year 5:$1 1.690 $Year 3:$10,603 Dante Fascell Park Year 1:$8,956 Year 4:$10,367 Year 2:$9,403 Year 5:$10,885 $Year 3:$9,873 Firm-Kleen-Tech Sendees,LLC1111*1•—nnmuSignad-hy: Authorized Signature:°'S25011BFC3114F1... Print or Type Name:-Tames Vaughan Date:^2025 Title:CEO KLEEN-TECH 44 of 92 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services, Section 3. NOTE: OVER THE TERM OF THE AGREEMENT, THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS, DEPENDING UPON CONDITIONS. IN THOSE CASES, THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES” MATRIX BELOW. A. ANNUAL FEE YEAR ANNUAL FEE Year 1 $ Year 2 $ Year 3 $ Year 4 (Option Year) $ Year 5 (Option Year) $ TOTAL $ B. SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch; City Hall (1st & 2nd Floor); Police Department (1st & 2nd Floor) $ Community Center (Multi-Purpose, Arts & Crafts Computer Lab & Education Room) $ Indoor Basketball Gymnasium/Bleachers $ Marshall Williamson building, commonly known as Mobley building $______________________ 43 of 92 44,739.36 36,219.03 16,805.08 19,077.71 129,917.33 133,814.85 137,829.30 141,964.18 689,748.77 146,223.10 2028 of 39 268 Senior Citizens Center $ Public Works $ Dante Fascell Park $______________________ Firm: Authorized Signature: Date: Print or Type Name: Title: 44 of 92 4,109.05 5,943.24 3,023.86 Klēn Space, Inc. BRIT RAWLINGS 01/22/2025 Chief Executive Officer (CEO) 2129 of 39 269 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services, Section 3. NOTE: OVER THE TERM OF THE AGREEMENT, THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS, DEPENDING UPON CONDITIONS. IN THOSE CASES, THE ANNUAL FEE WILL BE ADJUSTED A. ANNUAL FEE YEAR ANNUAL FEE Year 1 $ Year 2 $ Year 3 $ Year 4 (Option Year) $ Year 5 (Option Year) $ TOTAL$ B. SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch; City Hall (1st & 2nd Floor); Police Department (1st & 2nd Floor) $ Community Center (Multi-Purpose, Arts & Crafts Computer Lab & Education Room)$ Indoor Basketball Gymnasium/Bleachers $ Marshall Williamson building, commonly known as Mobley building $______________________ 43 of 92 91,964.58 94,723.52 94,723.52 94,723.52 31,599.00 26,608.16 5,401.78 13,454.05 89,285.57 465,420.71 22 30 of 39 270 USING THE “SCHEDULE OF VALUES”MATRIX BELOW. Senior Citizens Center $ Public Works $ Dante Fascell Park $______________________ Firm: Authorized Signature: Date: Print or Type Name: Title: 44 of 92 4,971.66 3,759.71 3,491.21 Marsden South Shazard Ali January 22, 2025 Director of Business Development 23 31 of 39 271 RFP #FN2024-17 – Janitorial Services – City of South Miami _______________________________________________________________________________________ MCJ Professional Cleaning Services 1905 NW 32nd ST, BAY 6, POMPANO BEACH, FL 33064 contact@mcjcleaning.com || www.mcjcleaning.com 20 Article 9. Form -7 Price proposal 32 of 39 272 MCJ PROFESSIONAL ('leaning Sendees FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services,Section 3. NOTE:OVER THE TERM OF THE AGREEMENT,THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS,DEPENDING UPON CONDITIONS.IN THOSE CASES,THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES”MATRIX BELOW. A.ANNUAL FEE YEAR ANNUAL FEE Year 1 S 206,559.60 Year 2 $211,723.59 Year 3 s 218,075.30 Year 4 (Option Year)s 225,053.71 Year 5 (Option Year)S 232,930.59 TOTAL $1,094,342.78 B.SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch;City Hall (Is1 &2nd Floor);Police Department (1 !*& 2nd Floor)$70,211.70 Community Center (Multi-Purpose, Arts &Crafts Computer Lab & Education Room)$73,482.50 Indoor Basketball Gymnasium/Bleachers $21,824.40 Marshall Williamson building, commonly known as Mobley building $24,788.40 43 of 92 RFP #FN2024-17 – Janitorial Services – City of South Miami _______________________________________________________________________________________ MCJ Professional Cleaning Services 1905 NW 32nd ST, BAY 6, POMPANO BEACH, FL 33064 contact@mcjcleaning.com || www.mcjcleaning.com 21 33 of 39 273 MCJ PROFESSIONAL ('leaning Sendees Senior Citizens Center S 7,540.00 Public Works S 5,072.60 Dante Fascell Park S 3,640.00 Firm:MCJ Professional Cleaning Services Authorized Signature:Op Print or Type Name:Maria Jose Watson Date:01/20/2025 Title:President 44 «r 92 274 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services,Section 3. NOTE:OVER THE TERM OF THE AGREEMENT,THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS,DEPENDING UPON CONDITIONS.IN THOSE CASES,THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES”MATRIX BELOW. A.ANNUAL FEE YEAR ANNUAL FEE Year 1 $ Year 2 $ Year 3 $ Year 4 (Option Year)S Year 5 (Option Year)s TOTAL $ B.SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch;City Hall (1st &2nd Floor);Police Department (1st & 2nd Floor)$ Community Center (Multi-Purpose, Arts &Crafts Computer Lab & Education Room)$ Indoor Basketball Gymnasium/Bleachers $ Marshall Williamson building, commonly known as Mobley building $ 43 of 92 01/22/2025 275 Senior Citizens Center i$ Public Works S Dante Fascell Park $ Firm:National Cleaning Qontractorts Authorized Signature: Print or Type Name:Guillermo Alfonso Date: Title:President 44 of 92 Page 23 of 126 PRICE PROPOSAL 34 of 39 276 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services,Section 3. NOTE:OVER THE TERM OF THE AGREEMENT,THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS,DEPENDING UPON CONDITIONS.IN THOSE CASES,THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES”MATRIX BELOW. A.ANNUAL FEE YEAR ANNUAL FEE Year 1 s Year 2 s V4H Hoc.°° Year 3 ) $\S4.SOT-.°° Year 4 (Option Year) /.,00* Year 5 (Option Year)s I"I S'.00 TOTAL —,—,—.©0 s +^3-.on B.SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch;City Hall (1st &2nd Floor);Police Department (1“& 2"d Floor)S Community Center (Multi-Purpose, Arts &Crafts Computer Lab & Education Room)$ Indoor Basketball Gymnasium/Bleachers $*IMS. Marshall Williamson building, commonly known as Mobley building $ 1 0 0 43 of 92 <||SFM^11Janitorial Page 24 of 126 35 of 39 277 Senior Citizens Center $(0^*° Public Works / Dante Fascell Park O os3,3 *0(0. Authorized Signature: Print or Type Name: Finn:SFM Janitorial Services.L Date:01/20/2025 Title:Manager 44 of 92 <||SFM^11Janitorial 36 of 39 278 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services,Section 3. NOTE:OVER THE TERM OF THE AGREEMENT,THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS,DEPENDING UPON CONDITIONS.IN THOSE CASES,THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES”MATRIX BELOW. A.ANNUAL FEE YEAR ANNUAL FEE Year 1 s 72 9 20-00 Year 2 $5 yt.OO ' Year 3 s Year 4 (Option Year)s /3/^OO. Year 5 (Option Year)$^00.OO TOTAL ,5GO /32 00 B.SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch;City Hall (1st &2nd Floor);Police Department (1SI & 2nd Floor)$3g 22^.OO Community Center (Multi-Purpose, Arts &Crafts Computer Lab & Education Room)Is /6 3 ?>0.002 Indoor Basketball Gymnasium/Bleachers s \C 320.00 Marshall Williamson building, commonly known as Mobley building }0 c]20 00 43 of 92 37 of 39 279 Senior Citizens Center s f H60.00 Public Works $S'S&O.00 Dante Fasccll Park s b'si 0.00 Title:Print or Type Name: Firm: Authorized Signature:7^r 44 of 92 Date: 1/22/2025 Time: 8:21:26 AM (US Central Time) Scanned From IP:10.76.76.9 38 of 39 280 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services,Section 3. NOTE:OVER THE TERM OF THE AGREEMENT,THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS,DEPENDING UPON CONDITIONS.IN THOSE CASES,THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES”MATRIX BELOW. A.ANNUAL FEE .. •YEAR IIIIOIliiM Year 1 $179390 179390 Year 2 $ Year 3 $ 179390 Year 4 (Option Year)$179390 179390 Year 5 (Option Year)$ TOTAL $896950 B.SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch;City Hall (1st &2nd Floor);Police Department (1st & 2nd Floor)$ 56400 Community Center (Multi-Purpose, Arts &Crafts Computer Lab & Education Room)$ 24000 Indoor Basketball Gymnasium/Bleachers $ 29950 Marshall Williamson building, commonly known as Mobley building $16500 43 of 92 Date: 1/22/2025 Time: 8:21:26 AM (US Central Time) Scanned From IP:10.76.76.9 39 of 39 281 Senior Citizens Center 17540 17500PublicWorks$ 17500 Dante Fascell Park $ Firm'W&G Maintenance Corp Authorized Signature:Wudson Fenelon Print or Type Name:W^son Fenelon Date:1/20/2025 Title:owner 44 of 92 Member Name City of South Miami Bid Number RFP-(RFP) No. FN2024-17-0-2024/SK Bid Name JANITORIAL SERVICES 51 Planholder(s) found 519 Notified SupplierName FullNameEmail Address1 City State Code Attributes 24 Hours, Inc.Mats Brunachejessica.diaz@24hclean.com4251 SW High Meadows Ave PALM CITY FL 34990 AK Building Services, INC SHARI CEDARscedar@akbuildingservices.net720 NW 7th Terrace Fort Lauderdale FL 33311 Amer-Plus Janitorial Maintenance LLC Stephannie Cetoutescetoute@amerpluscleaning.com1265 NE 203rd ST Miami FL 33179 American Facility Services, Inc.Stephanie Perezsperez@amfacility.com 1325 Union Hill Industrial Court, Suite A Alpharetta GA 30004 Asima Facility Management Nelia Mikhyeyevsales@shen-us.com1920 Hallandale blvd Hallandale Beach FL 33009 BLUE EDONIS LLC Jose Luis Valderramainfo@blueedonis.com5961 sw 68 st south miami Miami FL 33143 Building Service Industries LLC Tom Beatoninfo@bsinewyork.com3907 Woodview Dr Winston-Salem NC 27106 Carol Professional cleaning services llc Carolina Astesianocarolcleanllc@gmail.com2851 NE 183RD ST Aventura FL 33160 Certified Services Pro LLC Frank Rahmancertifiedservicespro@gmail.com7036 Bramblewood Dr New Port Richey FL 34668 Chi-Ada Corpororation Bart Okorobokoro@chiadacorporation.com4820 W commercial Blvd Tamarac FL 33319 City Shine Services, LLC Neven Radovanovicneven@cityshineservices.com200 72nd Ave N Saint Petersburg FL 33702 CLEAN SPACE INC.Lina Hernandezlhernandez@cleanspaceonline.com3764 NW 124th Ave Coral Springs FL 33065 Cleaning Management Systems Group INC Claudia De La Hozclaudiacleaning1@gmail.com150 S PINE ISLAND ROAD PLANTATION,FL FL 33324 Complete Contract Consulting Sharna Barnessbarnes@completecontractconsulting.com2001 BROADWAY AVENUE Atlanta GA 33404 ConstructConnect ConstructConnect Bid Opportunitiescontent@constructconnect.com3825 Edwards Rd Cincinnati OH 45209 D's Touch Landscaping LLC LATAJA MATHEWSD.STOUCHLANDSCAPING@GMAIL.COM21008 NW 39th street Miami Gardens FL 33056 Dodge Data Bonny Mangolddodge.docs@construction.com4300 Beltway Place, Ste 150 Arlington TX 76018 3 Document(s) found for this bid 282 Eco Clean Maintenance, Inc.Dylan Meyerdmeyer@ecocleanmaintenance.com515 W. Wrightwood Ave Elmhurst IL 60126 EDWARD THOMPSON LAWN CARE EDWARD THOMPSONTHOMPSONTHOMPSON5541@GMAIL.COM10880 SW 188TH STREET Miami FL 33177 African American Owned, Small Business, Woman Owned Egusquiza Office Solutions LLC Carlos Egusquizacarlosegusquiza@officepride.com1240 Eucalyptus Drive Hollywood FL 33021 General Facility Care LLC John Csehillgfc-hq@pm.me8370 West Hillsborough Ave Tampa FL 33615 Hispanic Owned, Small Business Green Facility, Inc chung leechung5829@gmail.com8530 nw 47th st coral springs FL 33067 Asian/Hawaiian Owned IC & G CLEANING SERVICES INC Guillermo Ferroicgclean@gmail.com7850 W McNab Rd Tamarac FL 33321 Image Companies Paul Saavedrapsaavedra@imagecompanies.com1750 N Florida Mango Rd West Palm Beach FL 33409 Small Business JNS Facility Maintenance Matt KashamMatt@jnscleaning.com3909 Research Park Ann Arbor MI 48108 Kleen-Tech Services, LLC Tracy Whitetwhite@kleen-tech.com7100 Broadway, Suite 6L Denver CO 80221 Klen Space Inc.Brit Rawlingsbids@klenspace.com240 West 73rd Street Naples FL 10023 Mama Rosa Cleaning Services, LLC Charles Bunnmamarosacleaningserviceinc@gmail.com7001 142nd Ave N suite 325 Largo FL 33764 Marsden Services Shaz Alisali@marsden.com4212 Greenway Dr Pompano Beach FL 33021 Mulberry Property Solutions, LLC sergio moralesmulberrypropertysolutions@gmail.com5463 NW 57th Way Margate FL 33067 Hispanic Owned, Small Business, Veteran Owned, Disabled Veteran National Cleaning Contractors USA Inc Guillermo Alfonsonationclean@comcast.net14482 SW 38 Lane Miami FL 33175 New Life Facility Services Joe Pradoadmin@newlifefacilities.com Lakeland FL Onvia, Inc. - Content Department Content Source Managementsourcingsupport@deltek.com509 Olive Way, Suite 400 Seattle WA 98101 P.C.S. Professional Cleaning Services Madid Pedrazampedraza@pcscleanup.com5800 s sable cir margate FL 33063 Hispanic Owned, Small Business, Woman Owned Padegenis Cleaning Inc.Kerri Padegeniskerri@padegeniscleaning.com1709 Saratoga Dr Titusville FL 32796 Precious Cleaning Solutions Precious Kehindedigitalsprecious@gmail.com Thonotosassa FL 283 Pritchard Industries Trisha Simontsimon@pritchardindustries.com10315 TRAINON PLACE New York FL 33449 SCSI Russell Meteviarmetevia@scsione.com11482 Columbia Park Drive JACKSONVILLE FL 32258 SFM Janitorial Services, LLC.Christian Infanteinfo@sfmservices.com7500 NW 74 Avenue Medley FL 33166 Shiny Operations Diego Leon Gutierrezdleong@shinyoperations.com4111 Coral Tree Circle Coconut Creek FL 33073 Spotless & Bright Cleaning Services Biyanca PaulInfo@spotlessbrightcleaning.com Fort Lauderdale FL Stratus Building Solutions of Miami Jennifer Poulosjpoulos@stratusclean.com7700 N Kendall Drive Miami FL 33156 Hispanic Owned, Small Business, Woman Owned, LGBT Owned Suny Hospitality Services LLC Andy EugeneAndyeugene@sunyhospitalityservices.com2800 Sw 22nd Ave Delray Beach FL 33445 Unlimited Cleaning Company, LLC Yaniel Quinones Diezunlimitedcleaning.fl@gmail.com4560 west 9 ct Hialeah FL 33012 USSI, Inc.Danna Hewickdhewick@eulen.com4340 East-West Highway Miami FL 20814 Valkyrie Exports LLC fabrice Auguste Valkyrieexportsllc@gmail.com2350 W oakland park blvd350 Fort Lauderdale FL 33311 Water Restoration Guys juan amayaInfo@waterrestorationguys.com12907 banyan rd Miami FL 33181 Hispanic Owned, Small Business, Woman Owned WeClean commercial cleaning Brigita Pintobrigita.pinto@wecleancommercialcleaning.com111 North Powerline road Deerfield Beach FL 33442 Wgmaintenance wudson feneloncwgaservices@gmail.com253 Wading Bird Circle Southwest Palm Bay FL 32908 African American Owned, Small Business WORLD ELITE SECURITY SERVICES DWAYNE RODGERSworldsec2@gmail.com Clermont FL ZipClean LLC Diana FranklinDianaf@zipzipcleanpro.org1928 NW 31st pl gainesville FL 32605 284 285February10,2025:JanitorialServicesRespondentShortListTOPFIVEFORINTERVIEWSBIDDERQ.POUGHA.MUNOZJ.BARZOLATOTALSCORESHORTLISTRANKSFM9695822731FLAPreferred8486782482MarsdenSouth8570802353KleenTech8190562274HighMaint.7569852295KlenSpace838063226CleanSpace(Incumbent)755980214Chi-Ada726577214AbleBusiness756075210Ameri-Plus687561204NationalCleaning725079201Goodwill696565199MCIProfessional705563188WGMaint.724566183CometCleaning/Alph574076173ELLA'SPROPERTY754040155ProAlliance/DVE575836151BossProTampa(4Yrs)575635148Unlimited643828130JBConsulting(Complete)505020120GREENFACILITYNONRESPONSIVE0 286proposer.RFPTitle:RFPNo.:EvaluationScoringSheetJANITORIALSERVICESFN2024-I7DIRECTIONS:Pleasescoreeachfirm,foreachspecificcriteriaprovided.Scoringisbasedoneachcriterialistedbelowwithamaximumscoreforeachcriteria.Thetotalscoreforeachproposeriscalculatedbyaddingeachcriteriaforatotalscorebyproposer.Themaximumscoretotalscoreforeachproposeris100points;withanadditional25pointsforanOralInterview,ifscheduled.TheOralInterviewscoreshallbeaddedtotheEvaluationCommitteesFinalScoreforeachProcurementDivision6130SunsetDriveSouthMiami,Florida33143(305)663-6339www.southmiamifl.govSouth’’MiamiTHECITYOFPLEASANTLIVINGCriteriaABLEBUSINESSMARSDENSOUTHELLA’SPROPERTYCLEANSPACEHIGHMAINT.I.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:30)/2020)2.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:257°2^2*3.References:References/goodstandingwithpreviousclients.MaximumPoints:300204.ProposedPricingMaximumPoints15p^i?6TotalScore:4-6RankPage1of6 287Page2of6CriteriaUNLIMITEDFLA.PREFERREDNATIONALCLEANINGKLENSPACEGREENFACILITY1.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices./MaximumPoints:30/%/dr7/2^42.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:25lb3.References:References/goodstandingwithpreviousclients.MaximumPoints:30If4.ProposedPricingMaximum15Pointss%ViTotalScore:7^Rank 288CriteriaCOMETCLEANINGCHI-ADAPROALLIANCE/DVECAPITALSFMKLEENTECH1.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:30/p50)^02.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:25//0lb3.References:References/goodstandingwithpreviousclients.MaximumPoints:30/D/4.ProposedPricingMaximum15Points7TotalScore:7^3krz-RankVPage3of6 289CriteriaWGMAINT.MCJPROFESSIOALGOODWILLAMERI-PLUSBOSSPRO1.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:3092.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:252^2393.References:References/goodstandingwithpreviousclients.MaximumPoints:30Zc)2-0/04.ProposedPricingMaximum15Points10S'TotalScore:RankPage4of6 290CriteriaJ.B.CONSULTING1.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:30)02.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:2553.References:References/goodstandingwithpreviousclients.MaximumPoints:304.ProposedPricingMaximumISPointsTotalScore:ZDRankAdditionalComments:Page5of6 291Page6of6 292South'*MiamiTHECITYOFPLEASANTLIVINGEvaluationScoringSheetProcurementDivision6130SunsetDriveSouthMiami,Florida33143(305)663-6339www.southmiamifl.govRFPTitle:RFPNo.:JANITORIALSERVICESFN2024-I7DIRECTIONS:Pleasescoreeachfirm,foreachspecificcriteriaprovided.Scoringisbasedoneachcriterialistedbelowwithamaximumscoreforeachcriteria.Thetotalscoreforeachproposeriscalculatedbyaddingeachcriteriaforatotalscorebyproposer.Themaximumscoretotalscoreforeachproposeris100points;withanadditional25pointsforanOralInterview,ifscheduled.TheOralInterviewscoreshallbeaddedtotheEvaluationCommitteesFinalScoreforeachproposer.CriteriaABLEBUSINESSMARSDENSOUTHELLA’SPROPERTYCLEANSPACEHIGHMAINT.I.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:302°2^2oz°zO2.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:25Z02°2OZolo3.References:References/goodstandingwithpreviousclients.MaximumPoints:30ZoZo204.ProposedPricingMaximumPoints15/r/</S'/5"TotalScore:777^7RankPage1of6 293CriteriaUNLIMITEDFLA.PREFERREDNATIONALCLEANINGKLENSPACEGRFACENLITY1.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:302^2.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:25/r2©2^3.References:References/goodstandingwithpreviousclients.MaximumPoints:30/r2°4.ProposedPricingMaximum15Points//H/Z13TotalScore:ev72-€>3RankPage2of6 294CriteriaCOMETCLEANINGCHI-ADAPROALLIANCE/DVECAPITALSFMKLEENTECH1.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:30127*2^2.Experience:Pastand/orcurrentexperience:includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:25z&)273.References:References/goodstandingwithpreviousclients.MaximumPoints:30)304.ProposedPricingMaximum15PointsI'7-I2-12nTotalScore:7^S781RankPage3of6 295CriteriaWGMAINT.MCJPROFESSIOALGOODWILLAMERI-PLUSBOSSPRO1.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:302°2-°if2.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:25)f3.References:References/goodstandingwithpreviousclients.MaximumPoints:30°4.ProposedPricingMaximum15Points1*2-}O87TotalScore:72-70^7RankPage4of6 296CriteriaJ.B.CONSULTING1.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:30)2.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:2513.References:References/goodstandingwithpreviousclients.MaximumPoints:30I4.ProposedPricingMaximumISPointsTotalScore:RankAdditionalComments:Page5of6 297Page6of6 2984South’MiamiTHFCITYOFPLEASANTLIVINGEvaluationScoringSheetProcurementDivision6130SunsetDriveSouthMiami,Florida33143(305)663-6339www.southmiamifl.govRFPTitle:RFPNo.:JANITORIALSERVICESFN2024-I7DIRECTIONS:Pleasescoreeachfirm,foreachspecificcriteriaprovided.Scoringisbasedoneachcriterialistedbelowwithamaximumscoreforeachcriteria.Thetotalscoreforeachproposeriscalculatedbyaddingeachcriteriaforatotalscorebyproposer.Themaximumscoretotalscoreforeachproposeris100points;withanadditional25pointsforanOralInterview,ifscheduled.TheOralInterviewscoreshallbeaddedtotheEvaluationCommitteesFinalScoreforeachproposer.CriteriaABLEBUSINESSMARSDENSOUTHELLA’SPROPERTYCLEANSPACEHIGHMAINT.I.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:302-03^।10702.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:25i70n3.References:References/goodstandingwithpreviousclients.MaximumPoints:30vO12^zG4.ProposedPricingMaximumPoints15^53»1'A1TotalScore:~l0RankPage1of6 299/CriteriaUNLIMITEDFLA.PREFERREDNATIONALCLEANINGKLENSPACEGREENFACILITY1.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:302.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:25lO3.References:References/goodstandingwithpreviousclients.MaximumPoints:302*?^04.ProposedPricingMaximum15Pointsv,.TotalScore:wRankPage2of6 300CriteriaCOMETCLEANINGCHI-ADAPROALLIANCE/DVECAPITALSFMKLEENTECH1.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:30\0n,0^02.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:25V’3.References:References/goodstandingwithpreviousclients.MaximumPoints:3010h3°4.ProposedPricingMaximumISPointso/(01^510ton?15^TotalScore:wW/RankInrPage3of6 301CriteriaWGMAINT.MCJPROFESSIOALGOODWILLAMERI-PLUSBOSSPRO1.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:30\^9\0zoK2.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:25ft103.References:References/goodstandingwithpreviousclients.MaximumPoints:30z^20iZ4.ProposedPricingMaximum15Points\o->07^tO10—i/TotalScore:Rank»1Page4of6 302CriteriaJ.B.CONSULTING1.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:302.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:25i03.References:References/goodstandingwithpreviousclients.MaximumPoints:304.2^ProposedPricingMaximum15PointsTotalScore:RankAdditionalComments:Page5of6 303Reviewedby:Date:^X9^71^2(PrintName)Page6of6 304February10,2025:JanitorialServicesRespondentShortListFINAL2/19/25TOPFIVEFORINTERVIEWS2/19/2025BIDDERQ.POUGHA.MUNOZJ.BARZOLATOTALSCORESHORTLISTRANKInterviewMax25PointsFINALTOTALFINALRANKSFM9695822731753481FLAPreferred8486782482583062MarsdenSouth8570802353622973HighMaint.7569852294602895KleenTech8190562275672944KlenSpace838063226CleanSpace(Incumbent)755980214Chi-Ada726577214AbleBusiness756075210Ameri-Plus687561204NationalCleaning725079201Goodwill696565199MCIProfessional705563188WGMaint.724566183CometCleaning/Alp574076173ELLA'SPROPERTY754040155ProAlliance/DVE575836151BossProTampa(4Yrs)575635148Unlimited643828130JBConsulting(Complete)505020120GREENFACILITY)NRESPONSIVE0 305South'1MiamiTHECITYOFPLEASANTLIVINGFINALEvaluationScoringSheetProcurementDivision6130SunsetDriveSouthMiami,Florida33143(305)663-6339www.southmiamifl.govRFPTitle:RFPNo.:JANITORIALSERVICESFN2024-I7DIRECTIONS:Pleasescoreeachfirm,foreachspecificcriteriaprovided.Scoringisbasedoneachcriterialistedbelowwithamaximumscoreforeachcriteria.Thetotalscoreforeachproposeriscalculatedbyaddingeachcriteriaforatotalscorebyproposer.Themaximumscoretotalscoreforeachproposeris100points;withanadditional25pointsforanOralInterview,ifscheduled.TheOralInterviewscoreshallbeaddedtotheEvaluationCommitteesFinalScoreforeachproposer.CriteriaSFMFLORIDAPREFERREDMARSDENSOUTHKLEENTECHHIGHMAINTENANCE1.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:3027252525202.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:2527202020203.References:References/goodstandingwithpreviousclients.MaximumPoints:3030252525204.ProposedPricingMaximumPoints15121415II15IScore:9684858175OralInterviewsMax25Points*2^biNFINALSCORE/211OHid77Page1of2 306Reviewedby:QUENTINROUGH(PrintName)Date:Page2of2 307South'1MiamiTHECITYOFPLEASANTLIVINGFINALEvaluationScoringSheetProcurementDivision6130SunsetDriveSouthMiami,Florida33143(305)663-6339www.southmiamifl.ovRFPTitle:RFPNo.:JANITORIALSERVICESFN2024-I7DIRECTIONS:Pleasescoreeachfirm,foreachspecificcriteriaprovided.Scoringisbasedoneachcriterialistedbelowwithamaximumscoreforeachcriteria.Thetotalscoreforeachproposeriscalculatedbyaddingeachcriteriaforatotalscorebyproposer.Themaximumscoretotalscoreforeachproposeris100points;withanadditional25pointsforanOralInterview,ifscheduled.TheOralInterviewscoreshallbeaddedtotheEvaluationCommitteesFinalScoreforeachproposer.CriteriaSFMFLORIDAPREFERREDMARSDENSOUTHKLEENTECHHIGHMAINTENANCEI.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:3030282530222.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:252520223.References:References/goodstandingwithpreviousclients.MaximumPoints:3030252025204.ProposedPricingMaximumPoints151085105IScore:867069OralInterviewsMax25Points201gFINALSCOREw0105wH3Page1of2 308Page2of2 309South'1MiamiTHECITYOFPLEASANTLIVINGFINALEvaluationScoringSheetProcurementDivision6130SunsetDriveSouthMiami,Florida33143(305)663-6339www.southmiamifl.govRFPTitle:RFPNo.:JANITORIALSERVICESFN2024-I7DIRECTIONS:Pleasescoreeachfirm,foreachspecificcriteriaprovided.Scoringisbasedoneachcriterialistedbelowwithamaximumscoreforeachcriteria.Thetotalscoreforeachproposeriscalculatedbyaddingeachcriteriaforatotalscorebyproposer.Themaximumscoretotalscoreforeachproposeris100points;withanadditional25pointsforanOralInterview,ifscheduled.TheOralInterviewscoreshallbeaddedtotheEvaluationCommitteesFinalScoreforeachproposer.77/35CriteriaSFMFLORIDAPREFERREDMARSDENSOUTHKLEENTECHHIGHMAINTENANCEI.Qualifications:CompetencyandtechnicalexpertiseofthefirmandpersonneltoperformtheservicesinaccordancewiththeScopeofServices.MaximumPoints:3030202520252.Experience:Pastand/orcurrentexperience;includingrelatedgovernmentexperienceofsimilarscopeandsize.MaximumPoints:2525252515303.References:References/goodstandingwithpreviousclients.MaximumPoints:3020252515254.ProposedPricingMaximumPoints1578565Score:82'78805685OralInterviewsMax25Points2^/<20FINALSCORE/(H/00Page1of2 310Date:(PrintName)AdditionalComments:Reviewedby:JOHNBARZOLAPage2of2 1 311 SouthTMiami THE CITY OF PLEASANT LIVING V.(786)643-6853 S info@floridapreferredgroup.com www.floridapreferredgroup.com FLORIDA PREFERRED GROUP Addressed to: Steven P.Kulick City of South Miami Chief Procurement Officer 6130 Sunset Drive City of South Miami,FL 33143 Email:skulick@southmiamifl.gov Project Manager: Jennifer Oves (786)643-6853 info@floridapreferredgroup.com PROPOSAL TO CITY OF SOUTH MIAMI RFP NO.FN2024-17 FOR “JANITORIAL SERVICES” 3806 SW 148th Avenue,Miami,FL,33185 TABLE OF CONTENTS LETTER OF INTEREST…………………………………………………………………pg. 3 PROPOSAL FORM PACKAGE…………………………….……………………….…..pg. 5 FORM 1…………………………….……………………….………………..…...pg. 5 FORM 2A…………………………….……………………….………………..…pg. 7 FORM 3…………………………….………………………….……………..…...pg. 8 FORM 4…………………………….……………………………….………..…...pg. 15 FORM 5…………………………….……………………………….………..…...pg. 16 FORM 6…………………………….…………………………….…………..…...pg. 17 FORM 7…………………………….…………………………….…………..…...pg. 20 FORM 8…………………………….………………………….……………..…...pg. 22 FORM 9…………………………….……………………….………………..…...pg. 32 PROOF OF EXPERIENCE……….……………………………………………………...pg. 34 PREVIOUS PROJECTS………………………………..………………………………...pg. 39 PROPOSER’S QUALIFICATIONS……………………….…………..………………....pg. 47 SERVICE AND INCORPORATION….……………………..……..……………..pg. 49 LICENSES……………………………………….………………..……………….pg. 52 PERSONNEL QUALIFICATIONS……………..…………………………………………pg. 54 KEY STAFF………………………...……….…………….…………….…………pg. 55 ORGANIZATIONAL CHART……………………….…………….……………...pg. 58 INSURANCE CERTIFICATES…………………………………….……………………..pg. 59 2 312 LETTER OF INTEREST January 22, 2025 City of South Miami 6130 Sunset Drive City of South Miami, FL 33143 To whom it may concern, I, Jennifer Oves, CEO of Florida Preferred Group, am pleased to express my interest in the Request for Proposal (RFP) for janitorial services issued by the City of South Miami. Our team has thoroughly reviewed the RFP and is fully prepared to meet all submittal requirements and address the City’s unique needs. Florida Preferred Group is committed to delivering exceptional cleaning and maintenance services, tailored to align with the standards and expectations outlined in the RFP. Our approach emphasizes: ● Customized Cleaning Plans: Tailored to the specific requirements of each facility, considering foot traffic and usage patterns. ● Sustainability: Incorporating eco-friendly products and practices to minimize environmental impact. ● Advanced Equipment: Utilizing state-of-the-art technologies for thorough and efficient cleaning. ● Trained Professionals: A dedicated team that prioritizes safety, compliance, and attention to detail. ● Quality Assurance: Regular inspections and feedback mechanisms to ensure consistent service excellence. We understand the importance of maintaining clean and safe environments for the City’s employees and visitors. As a reputable service provider, we are eager to bring our expertise to this partnership and exceed expectations through our dedication to quality and efficiency. FPG’s approach and philosophy is taking pride in the cleanliness of our facilities, so our standard includes focusing heavily on details. Working with our company also means being environmentally conscious, since we use products that are environmentally friendly. Since we have experience with the resources, equipment, staff, and services outlined in the RFP, Florida Preferred Group is confident that we will be able to excel in the required facilities. All of our staff goes through several mandatory training sessions that ensure they are well rounded on the concept of product usage and safety/emergency procedures. FPG’s administration E-Verifies all of their employees and runs their background checks through ADP. In addition, our employees have a specific uniform that is distributed to them when they are hired. 3 313 FPG has a set of supervisors and managers that are trained and qualified to ensure that the employees can and will do their jobs correctly. If there are any issues, FPG has a system of reporting that will take care of the problem as quickly as possible. Supervisors are responsible for creating and delivering a cleaning plan that works. FPG as a company will monitor the cleaning schedule to make sure it is working. If anything needs to be changed the supervisors will make the appropriate changes. FPG uses a Quality Control Software named “Orange QC” which ensures that all employees have the knowledge to perform their job, and that all employees are following company protocol and obeying the cleaning tasks. It allows the FPG Quality Control Manager to perform routine inspections right from her tablet, monitor account performances & send real time alerts based on triggers you set, and generate reports for clients. If anything, other than a “Satisfactory” is entered, the system will provide a report suggesting actions to be taken. The end user is to refer to a supervisor, immediate action is required, or high risk (hazardous situations to health or safety). The report will show all satisfactory areas that are in need of attention. A ticket is then issued to the supervisor and/or manager in charge. They are responsible to communicate a copy of the report to the cleaners so that they are able to address all concerns and clear the ticket within 48 hours. If the City of South Miami has any complaints, FPG has a plan in place to handle the situation. FPG plans to handle complaints from the City of South Miami due to nonperformance by first addressing the complaint on a situational basis. First, we will evaluate the complaint, then directly speak to the supervisor in charge and assess the issue. We will create a plan to properly address the issue within 24 hours and have the issue corrected within 48 hours. The employee will be written up and will be carefully monitored to ensure that FPG’s standards are met. Thank you for considering our proposal. Should you have any questions or require further clarification on any aspect of our proposal submission, please do not hesitate to contact us. We are eager to discuss any additional details or requirements and are available for a presentation or meeting as needed. Sincerely, Jennifer Oves CEO, Florida Preferred Group 3806 SW 148th Ave, Miami, FL 33185 (786) 838-8029 | jenny@floridapreferredgroup.com 4 314 PROPOSAL FORM PACKAGE FORM 1 5 315 FORM 1 PROPOSAL FORM PACKAGE ACKNOWLEDGEMENTS I hereby propose to furnish the goods and services specified in the Request for Proposals,RFP No.FN2024-17.I agree that my Proposal will remain firm for a period of 180 days after opened by the City in order to allow the City adequate time to evaluate the Proposal. I certify that all information contained in this Proposal is truthful to the best of my knowledge and belief.I further certify that I am duly authorized to submit this Proposal on behalf of the Firm named as the Proposing Firm and that said Firm is ready,willing,and able to perform if awarded the Agreement. I further certify,under oath,that this Proposal is made without prior understanding,agreement, connection,discussion,or collusion with any other person,firm or corporation submitting a Proposal;no officer,employee or agent of the City of South Miami or any other Proposer has an interest in said Proposal.Furthermore,1 certify that the undersigned executed this Proposal Form with full knowledge and understanding of matters therein contained and was duly authorized. I further certify that the Proposer acknowledges receipt of all Addenda issued by the City in connection with the RFP (Check the box next to each addendum received). Addendum 1 'Addendum 2 Addendum 3 Addendum 4 Addendum 5 Addendum 6 Addendum 7 Addendum 8 Addendum 9 Addendum 1 0 Attached hereto are the following forms/documents which form a part of this Proposal: Form 1. Form 2A. Form 2B. Form 3. Form 4. Form 5. Proposal Form Package Acknowledgement. Proposer’s Certification (if Company or Corporation) Proposer’s Certification (if Partnership) Single Execution Affidavits Dispute Disclosure Certification Regarding Debarment,Suspension,&Other Responsibility Matters Primary Covered Transactions Form 6. Form 7. Form 8. Form 9. Proposer’s Qualifications Survey Price Proposal Form Reference List Key Staff &Proposed Subcontractors 27 of 92 6 316 FORM 1 PROPOSAL FORM PACKAGE ACKNOWLEDGEMENTS (CONTINUED) NAME OEPROPOSER FIRM SIGNATURE OF PROPOSER XlMXlMLCfONAME&TITLE,TYPEb OR PRINTED MAILING ADDRESS mikIfvm,H-22125 TELEPHONE NUMBER State of Florida County of 061 The foregoing instrument was acknowledged before me by means of physical presence or _ online notarization,this /,6^day of J6(nU6lHJ ,202^,by jCnnwe TOl/C b (name of person)as CCQ (type of authority)forR0/]6t6 PfT if (n°(l ^T1 XAiame of party on behalf of whom instrument is executed). X Personally known to me;or -Notary Public (Print,Stamp,or Type as Commissioned) Produced identification (Type of Identification: ) Did take an oath;or Did not take an oath 28 of 92 FORM 2A 7 317 FORM 2A PROPOSER’S CERTIFICATION (if Company or Corporation) CERTIFICATE ASTATEOF ) COUNTY OF Difani ) I HEREBY CERTIFY that a meeting of the Board of Directors of a corporation or company existing under the laws of the State of , held on 202^the following resolution was duly passed and adopted: RESOLVED,that,as C ^O of the Corporation/Company,be and is hereby authorized to execute the Proposal dated,,202$to the City of South Miami for RFP No.FN2024-17 “Janitorial Services,”and that this execution thereof,attested by the Secretary of the Corporation/Company,and with the Corporate/Company Seal affixed,shall be the official act and deed of this Corporation/Company. I further certify that said resolution is now in full force and effect. IN WITNESS WHEREOF,I have corporation/company on this the Notary Public State of Florida 571453 29 of 92 FORM 3 8 318 FORM 3 SINGLE EXECUTION AFFIDAVITS This form must be signed and sworn to in the presence of a notary public OR OTHER OFFICIAL AUTHORIZED TO ADMINISTER OATHS. THIS FORM COMBINES SEVERAL AFFIDAVIT STATEMENTS TO BE SWORN TO BY THE PROPOSER OR PROPOSER AND NOTARIZED BELOW.IN THE EVENT THE PROPOSER OR PROPOSER CANNOT SWEAR TO ANY OF THESE AFFIDAVIT STATEMENTS,THE PROPOSER OR PROPOSER IS DEEMED TO BE NON¬ RESPONSIBLE AND IS NOT ELIGIBLE TO SUBMIT A PROPOSAL/PROPOSAL. THESE SINGLE EXECUTION AFFIDAVITS ARE SUBMITTED TO THE CITY OF SOUTH MIAMI AND ARE STATEMENTS MADE: By:arfJ For (Name of Proposing or Bidding Entity):flOndd Prrtcirtd Whose business address is:^^06 Ml<^|I j/S And (if applicable)its Federal Employer Identification Number (FEIN)is:33 (if the entity does not have an FEIN,include the Social Security Number of the individual signing this sworn statement.SS#:) Americans w ith Disabilities Act Compliance Affidavit The above named firm,corporation or organization is in compliance with and agrees to continue to comply with,and assure that any subcontractor,or third party contractor under this project complies with all applicable requirements of the laws listed below including,but not limited to, those provisions pertaining to employment,provision of programs and services,transportation, communications,access to facilities,renovations,and new construction.•The American with Disabilities Act of 1990 (ADA),Pub.L.101-336,104 Stat 327,42 USC 1210112213 and 47 USC Sections 225 and 661 including Title I,Employment;Title II,Public Services;Title III,Public Accommodations and Services Operated by Private entities;Title IV,Telecommunications;and Title V,Miscellaneous Provisions.•The Florida Americans with Disabilities Accessibility Implementation Act of 1993, Section 553.501-553.513,Florida Statutes:•The Rehabilitation Act of 1 973,229 USC Section 794;•The Federal Transit Act,as amended 49 USC Section 1612;•The Fair Housing Act as amended 42 USC Section 360 1 -3631 . TOProposer Initials 31 of92 9 319 Public Entity Crimes Affidavit I understand that a “public entity crime”as defined in Paragraph 287.133(l)(g),Florida Statutes, means a violation of any state or federal law by a person with respect to and directly related to the transaction of business with any public entity or with an agency or political subdivision of anyotherstateoroftheUnitedStates,including but not limited to,any Proposal or contract for goods or services to be provided to any public entity or an agency or political subdivision of any other state or of the United States and involving antitrust,fraud,theft,bribery,collusion,racketeering, conspiracy,or material misrepresentations. I understand that “convicted”or “conviction”as defined in Paragraph 287.1 33(1 )(b),Florida Statutes,means a finding of guilt or a conviction of a public entity crime,with or without an adjudication of guilt,in any federal or state trial court of record relating to charges brought by indictment or information after July 1,1989,as a result of a jury verdict,non-jury trial,or entry of a plea of guilty or nolo contendere. I understand that an “affiliate”as defined in Paragraph 287.1 33(1 )(a),Florida Statutes,means: 1.A predecessor or successor of a person convicted of a public entity crime;or 2.An entity under the control of any natural person who is active in the management of the entity and who has been convicted of a public entity crime.The term “affiliate”includes those officers, directors,executives,partners,shareholders,employees,members,and agents who are active in the management of an affiliate.The ownership by one person of shares constituting a controlling interest in another person,or a pooling of equipment or income among persons when not for fair market value under an arm’s length agreement,shall be a prima facie case that one person controls another person.A person who knowingly enters into a joint venture with a person who has been convicted of a public entity crime in Florida during the preceding 36 months shall be considered an affiliate. I understand that a “person”as defined in Paragraph 287.1 33(1 )(e),Florida Statutes,means any natural person or entity organized under the laws of any state or of the United States with the legal power to enter into a binding contract and which proposals or applies to Proposal on contracts for the provision of goods or services let by a public entity,or which otherwise transacts or applies to transact business with a public entity.The term “person”includes those officers,directors, executives,and partners,shareholders,employees,members,and agents who are active in management of an entity. Based on information and belief,the statement,which I have marked below,is true in relations to the entity submitting this sworn statement. (INDICATE WHICH STATEMENT APPLIES.) V Neither the entity submitting this sworn statement,nor any of its officers,directors, "executives,partners,shareholders,employees,members,or agents who are active in the management of the entity,nor any affiliate of the entity has been charged with ad convicted of a public entity crime subsequent to July I,1989. The entity submitting this sworn statement,or one or more of its officers,directors, executives,partners,shareholders,employees,members,or agents who are active in the 32 ot 92 10 320 management of the entity,or an affiliate of the entity has been charged with and convicted of a public entity crime subsequent to July 1,1989. The entity submitting this sworn statement,or one or more of its officers,directors, executives,partners,shareholders,employees,members,or agents who are active in the management of the entity,or an affiliate of the entity has been charged with and convicted of a public entity crime subsequent to July 1,1989.However,there has been a subsequent proceeding before a Hearing Officer of the State of Florida ,Division of Administrative Hearings and the final Order entered by the Hearing Officer determined that it was not in the public interest to place the entity submitting this sworn statement on the convicted vendor list (attach a copy of the final order). 1 understand that the submission of this form to the contracting officer for the public entity identified in paragraph 1 above is for that public entity only and that this form is valid through December 31 of the calendar year in which it is filed.I also understand that I am required to inform the public entity prior to entering into a contract in excess of the threshold amount provided in Section 287.017,Florida Statutes for category two of any change in the information contained in this form. Proposer Initials No Conflict of Interest or Contingent Fee Affidavit Proposer warrants that neither it nor any principal,employee,agent,representative nor family member has paid or will pay any fee or consideration that is contingent on the award or execution of a contract arising out of this solicitation.Proposer also warrants that neither it nor any principal, employee,agent,representative nor family member has procured or attempted to procure this contract in violation of any of the provisions of the Miami-Dade County and City of South Miami conflict of interest or code of ethics ordinances.Further,Proposer acknowledges that any violation of these warrants will result in the termination of the contract and forfeiture of funds paid or to be paid to the Proposer should the Proposer be selected for the performance of this contract. Proposer Initials Business Entity Affidavit Proposer hereby recognizes and certifies that no elected official,board member,or employee of the City of South Miami (the "City”)shall have a financial interest directly or indirectly in this transaction or any compensation to be paid under or through this transaction,and further,that no City employee,nor any elected or appointed officer (including City board members)of the City, nor any spouse,parent or child of such employee or elected or appointed officer of the City,may be a partner,officer,director or proprietor of Proposer or Vendor,and further,that no such City employee or elected or appointed officer,or the spouse,parent or child of any of them,alone or in combination,may have a material interest in the Vendor or Proposer.Material interest means direct or indirect ownership of more than 5%of the total assets or capital stock of the Proposer.Any exception to these above described restrictions must be expressly provided by applicable law or ordinance and be confirmed in writing by City.Further,Proposer recognizes that with respect to this transaction or Proposal,if any Proposer violates or is a party to a violation of the ethics 33 of 92 11 321 ordinances or rules of the City,the provisions of Miami-Dade County Code Section 2-11.1,as applicable to City,or the provisions of Chapter 1 12,part 111,Fla.Stat.,the Code of Ethics for Public Officers and Employees,such Proposer may be disqualified from furnishing the goods or services for which the Proposal or Proposal is submitted and may be further disqualified from submitting any future proposals or Proposal for goods or services to City. Proposer Initials Anti-Collusion Affidavit I .Proposer/Proposer has personal knowledge of the matters set forth in its Proposal/Proposal and is fully informed respecting the preparation and contents of the attached Proposal/Proposal and all pertinent circumstances respecting the Proposal/Proposal; 2.The Proposal/Proposal is genuine and is not a collusive or sham Proposal/Proposal;and 3.Neither the Proposer/Proposer nor any of its officers,partners,owners,agents,representatives, employees,or parties in interest,including Affiant,has in any way colluded,conspired, connived,or agreed,directly or indirectly with any other Proposer/Proposer,firm,or person to submit a collusive or sham Proposal/Proposal,or has in any manner,directly or indirectly, sought by agreement or collusion or communication or conference with any other Proposer/Proposer,firm,or person to fix the price or prices in the attached Proposal/Proposal or of any other Proposer/Proposer,or to fix any overhead,profit,or cost element of the Proposal/Proposal price or the Proposal/Proposal price of any other Proposer/Proposer,or to secure through any collusion,conspiracy,connivance or unlawful agreement any advantage against the City or any person interested in the proposed Contract. Proposer Initials Scrutinized Company Certification 1.Proposer certifies that it and its subcontractors are not on the Scrutinized Companies that Boycott Israel List.Pursuant to Section 287.135,F.S.,the City may immediately terminate the Agreement that may result from this RFP at its sole option if the Proposer or its subcontractors are found to have submitted a false certification;or if the Proposer,or its subcontractors are placed on the Scrutinized Companies that Boycott Israel List or is engaged in the boycott of Israel during the term of the Agreement. 2.If the Agreement that may result from this RFP is for more than one million dollars,the Proposer certifies that it and its subcontractors are also not on the Scrutinized Companies with Activities in Sudan,Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List,or engaged with business operations in Cuba or Syria as identified in Section 287.135,F.S.pursuant to Section 287.135,F.S.,the City may immediately terminate the Agreement that may result from this RFP at its sole option if the Proposer,its affiliates,or its subcontractors are found to have submitted a false certification;or if the Proposer,its affiliates, or its subcontractors are placed on the Scrutinized Companies with Activities in Sudan List,or 34 of 92 12 322 Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List,or engaged with business operations in Cuba or Syria during the term of the Agreement. 3.The Proposer agrees to observe the above requirements for applicable subcontracts entered into for the performance of work under the Agreement that may result from this RFP.As provided in Subsection 287.135(8),F.S.,if federal law ceases to authorize the above-stated contracting prohibitions then they shall become inoperative. Proposer Initials Drug-Free Workplace Affidavit Proposer hereby recognizes that,pursuant to F.S.§287.087,preference shall be given to businesses with drug-free workplace programs when two proposals/Proposal are equal with respect to price,quality,and service.Proposer understands that in order to qualify as a drug-free workplace,Proposer must: a)Publish a statement notifying employees that the unlawful manufacture,distribution, dispensing,possession,or use of a controlled substance is prohibited in the workplace and specifying the actions that will be taken against employees for violations of such prohibition. b)Inform employees about the dangers of drug abuse in the workplace,the Proposer’s policy of maintaining a drug-free workplace,any available drug counseling,rehabilitation,and employee assistance programs,and the penalties that may be imposed upon employees for drug abuse violations. I)Give each employee engaged in providing commodities or contractual services under the RFP a copy of the statement specified in subsection (1). 2)Notify employees that,as a condition of working on the commodities or contractual services under the RFP,the employee must abide by the terms of the statement and will notify the employer of any conviction of,or plea of guilty or nolo contendere to,any violation of chapter 893 or of any controlled substance law of the United States or any state,for a violation occurring in the workplace no later than five (5)days after such conviction. 3)Impose a sanction on,or require the satisfactory participation in a drug abuse assistance or rehabilitation program if such is available in the employee’s community,by any employee who is so convicted. 4)Make a good faith effort to continue to maintain a drug-free workplace through the implementation of this section. Based on information and belief,the statement,which I have marked below,is true in relations to the entity submitting this sworn statement. (INDICATE WHICH STATEMENT APPLIES.) The entity submitting this sworn statement is a drug-free workplace and is in full 35 of 92 13 323 compliance with the requirements set forth under F.S.§287.087. The entity submitting this sworn statement is not a drug-free workplace. tO Proposer Initials City Non-Discrimination Requirements Affidavit Proposer understands that pursuant to Section 3-1.1 of the Code of the City of South Miami,the City will not enter into or award a contract to an entity engaged in a boycott. Proposer understands that “Boycott”as defined under Section 3-1.1 of the Code of the City of South Miami means to blacklist,divest from,or otherwise refuse to deal with a nation or country, or to blacklist or otherwise refuse to deal with a person or entity when the action is based on race, color,national origin,religion,sex,gender identity,sexual orientation,marital or familial status, age,or disability in a discriminatory manner.The term boycott does not include a decision based upon business or economic reasons,or boycotts,embargoes,trade restrictions,or divestments that are specifically authorized or required by federal law or state law. Proposer certifies that it is not engaged in a boycott,and is in full compliance with Section 3-1.1 of the Code of the City of South Miami. Proposer Initials Acknowledgment,Warranty,and Acceptance 1.Contractor warrants that it is willing and able to comply with all applicable state of Florida laws,rules and regulations. 2.Contractor warrants that it has read,understands,and is willing to comply with all requirements of RFP No.FN2024-03 and any addendum/addenda related thereto. 3.Contractor warrants that it will not delegate or subcontract its responsibilities under an agreement without the prior written permission of the City Commission or City Manager,as applicable. 4.Contractor warrants that all information provided by it in connection with this Proposal is true and accurate.tO Proposer Initials [REMAINDER OF PAGE LEFT INTENTIONALLY BLANK. SIGNATURE PAGE FOLLOWS.) 36 of 92 14 324 In the presence of:Signed,sealed and delivered by: Witness #1 Print Name:RShMM RiYVro Print N^meCjr FV)(J C < A Title:Q r U Witness #2 Print Name: ACKNOWLEDGMENT State of Florida County of Uyd^-- The foregoing instrument was acknowledged before me by means of physical presence or _ online notarization,this12-day of ,20 bvSnrdEcr 0^^ (name of person)as C'(type of authority)for Grcxptname of party on behalf of whom instrument is executed). Notary Public State of Florida Jenny Cabrera n My Commission HH 571453Expires7/13/2028 Notary Public (Print,Stamp,or Type as Commissioned) < *- Personally known to me;or Produced identification (Type of Identification: ) Did take an oath;or Did not take an oath 37 of 92 FORM 4 15 325 FORM 4 DISPUTE DISCLOSURE Answer the following questions by placing an “X”after “Yes”or “No”.If you answer “Yes”, please explain in the space provided,or on a separate sheet attached to this form. 1.Has your firm or any of its officers,received a reprimand of any nature or been suspended by the Department of Professional Regulations or any other regulatory agency or professional associations within the last five (5)years? YES NO V 2.Has your firm,or any member of your firm,been declared in default,terminated or removed from a contract or job related to the services your firm provides in the regular course of business within the last five (5)years? YES NO X 3.Has your firm had against it or filed any requests for equitable adjustment,contract claims, Proposal protests,or litigation in the past five (5)years that is related to the services your firm provides in the regular course of business? YES NO y If yes,state the nature of the request for equitable adjustment,contract claim,litigation,or protest, and state a brief description of the case,the outcome or status of the suit and the monetary amountsofextendedcontracttimeinvolved. I hereby certify that all statements made are true and agree and understand that any misstatementormisrepresentationoffalsificationoffactsshallbecauseforforfeitureofrightsforfurtherconsiderationofthisProposalorProposalfortheCityofSouthMiami. ACKNOWLEDGMEM State of Florida i ~County of /XI I DC(C]^ ice or online notarization, Notary PubHc^Print,Stamp,or Type as Commissioned) The foregoing instrument was acknowledged before me by means ofX^physical presentthisZ^ay of 20^by ATI1/^(name of person)as Ct .(J £(type of authority)forofpartyonbehalfofwhominstrumentisexecuted). NoUry Public Sute ct Funda Jenny Cabrera My Commission HH 571453lb11™Expires TH 3/2028 ‘^■PuwijHiHlltl^ll III iHe.of* Produced identification (Type of Identification:) Did take an oath;or Did not take an oath J8of92 FORM 5 16 326 FORM 5 CERTIFICATION REGARDING DEBARMENT,SUSPENSION,AND OTHER RESPONSIBILITY MATTERS PRIMARY COVERED TRANSACTIONS This certification is required by the regulations implementing Executive Order 12549,Debarment and Suspension,13 CFR Part 145.The regulations were published as Part VII of the May 26,1988 Federal Register (pages 19160-1921 1).Copies of the regulations are available from local offices of the U.S.Small Business Administration. (1 )The prospective primary participant certifies to the best of its knowledge and belief that it and its principals: (a)Are not presently debarred,suspended,proposed for disbarment,declared ineligible,or voluntarily excluded from covered transactions by any Federal department or agency; (b)Have not within a three-year period preceding this application been convicted of or had a civil judgment rendered against them for commission of fraud or a criminal offense in connection with obtaining,attempting to obtain,or performing a public (Federal,State,or local)transaction or contract under a public transaction; violation of Federal or State antitrust statutes or commission of embezzlement, theft,forgery,bribery,falsification or destruction of records,making false statements,or receiving stolen property; (c)Are not presently indicted for or otherwise criminally or civilly charged by a governmental entity (Federal,State,or local)with commission of any of the offenses enumerated in paragraph (1 )(b)of this certification;and (d)Have not within a three-year period preceding this application had one or more public transactions (Federal,State,or local)terminated for cause or default. (2)Where the prospective primary participant is unable to certify to any of the statements in this certification,such prospective primary participant shall attach an explanation to this Statement of Qualifications. Business Name ,L-LC Date JCD ZZ ,ZOl} Representative Name and Title of Authorized Representative 39 of 92 FORM 6 17 327 FORM 6 PROPOSER’S QUALIFICATIONS SURVEY COMPANY QUALIFICATIONS QUESTIONNAIRE Please complete this Company Qualifications Questionnaire.By completing this form and submitting a response to the RFP,you certify that any and all information contained in the Proposal is true,that your response to the RFP is made without prior understanding,agreement,or connections with any corporation,firm or person submitting a response to the RFP for the same materials,supplies,equipment,or services,is in all respects fair and without collusion or fraud, that you agree to abide by all terms and conditions of the RFP,and certify that you are authorized to sign for the Proposer’s firm. Some responses may require the inclusion of separate attachments.Separate attachments should be as concise as possible,while including the requested information.In no event should the total page count of all attachments to this Form exceed five (5)pages.Some information may not be applicable;in such instances,please insert “N/A”. Fl 6nria pr^grr FrDop,LlC Firm Name ^OLp ALO AVf,Fc 33i^V Principal Business Address 7?^LP43-WS3 Telephone Number Facsimile Number Email Address Federal I.D.No.or Social Security Number ~?2.<^f 3 Municipal Business Tax/Occupational License No. FIRM HISTORY AND INFORMATION How many years has the firm has been in business under its current name and ownership?-3 Please identify the Firm’s document number with the Florida Division of Corporations and date the Firm registered/filed to conduct business in the State of Florida: Document Number Date Filed Please identify the Firm’s category with the Florida Department of Business Professional Regulation (DBPR),DBPR license number,and date licensed by DBPR: ,Category License No.Date Licensed 40 of 92 18 328 Please indicate the type of entity form of the Firm (if other,please describe): Individual Partnership Corporation^LLC LLP Other Please identify the Firm’s primary business:/ Please identify the number of continuous years your Firm has performed its primary business: Please list all professional licenses and certifications held by the Firm,its Qualifier/Principal,and any Key Staff,including any active certifications of small,minority,or disadvantaged business enterprise,and the name of the entity that issued the license or certification: License/Certification Type Name of Entity Issuing License or Certification License No.License Issuance Date m lOm rDCMf,(71/»y oug id.zozd I.OME th /dm.**ynsry Please identify the name,license number,and issuance date of any prior companies that pertain to your Firm: License/Certification Type Name of Entity Issuing License or Certification License No.License Issuance Date n Id . Please identify all individuals authorized to sign for the entity,their title,and the threshold/level of their signing authority: Authorized Signor’s Name Title Signing Authority Threshold (All,Cost up to $X-Amount.No Cost.Other) rnmfrr (XT7 cm CLC • Please identify the total number of Firm employees,managerial/administrative employees,and identify the total number of trades employees by trade (e.g.,20 electricians,5 laborers,2 Please provide the following information about the Firm’s insurance company: K । co w ic hat i c/_ Insurance Carrier Name Insurance Carrier Contact Person Total No.of Employees 12.0 Total No.of Managerial/Administrative Employees |O Total No.of Trades Employees by Trade IIO citQncrs 41 of 92 19 329 203^IVI II JU fl C Insurance Carrier Address Telephone?No, 2 3Z-30 pmail Has Ihe Firm filed an}injurants claims in the Inst five (5}years?C^c>0 Yw H fHittM identify Ihe 1s pc if ll;inn and rhe amounl paid out under the claim: FIRM OWNERSHIP Owner,Partner Name 1 itk Ownership (%) Trnmtn nt.rr rro ! i.if f fie-Odn^q rz.fiya/TfXnfr 17J Please nlenlih 1 imi owners er ti.initcrs.ihejr tide,and nercent of ownershin: Please identify w hether any nftbc vw nerstpartners identified above arc owners,''partners in another entity n No b(Ycs If yes,please identify the name of the owner,'partner,the othei entity's name,and percent of ownership IteId by the stated owner,'partner Owner,'Portner Name Other Entity Name Owitership i.li?^a-adf\^urr.Auwrhf r .too/ RECENT CONTRACTSPleaseidentifythefive(5)most recent contracts in which your firm has provided services to otherpublicentities; Telephone No.Contact Persian Kjusmoi 7 .'VA-$V^Ml 4q74thu-iiQS CtfCM y pajQntoi \jg>ttzoZUlqTUw^neoefc GW Date:i Z By signing below.Proposer certifies that Ihe informsticin containedherein iscomplete and accurate tn the best of Proposer's knowledge. Fim;_FLQn^ftrttrnd Jwp,ljC liQft.it t/Tfs Public Entity Name Authorized Signature:_^5 Print or Type Name:a^ff -COWt turn /XIHS Email Address Date Aw arded 12 ur n FORM 7 20 330 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services,Section 3. NOTE:OVER THE TERM OF THE AGREEMENT,THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS,DEPENDING UPON CONDITIONS.IN THOSE CASES,THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES”MATRIX BELOW. A.ANNUAL FEE YEAR ANNUAL FEE Year 1 s HO,2?0.0G Year 2 $UQ .20^ Year 3 $I n.i/>3Q.scl^. Year 4 (Option Year)S M/,IGI-^S Year 5 (Option Year)s TOTAL £,031.012L B.SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch;City Hall (1st &2nd Floor);Police Department (1st & 2nd Floor)s Community Center (Multi-Purpose, Arts &Crafts Computer Lab & Education Room)$DO Indoor Basketball Gymnasium/Bleachers $5,OO Marshall Williamson building, commonly known as Mobley building $IO,330 00 43 of 92 21 331 Senior Citizens Center $HO®00 Public Works $IO, Dante Fascell Park $&,Ol+O.OQ Authorized Signature: Print or Type Name:_ Date:. Title: AtT-rm?6ro»p,llc 44 of 92 FORM 8 22 332 FORM 8 REFERENCE LIST IN ADDITION TO THE INFORMATION REQUIRED ON THIS FORM, PROPOSER SHALL PROVIDE A MINIMUM OF FOUR (4)REFERENCE LETTERS. REFERENCE #1 Public Entity Name:/C 0 Ml I Reference Contact Person/Title/Department: AnJ-nmy Contact Number &Email (7(j C4 Pl (JW /3 M ^6X^1 I OU 0^30 Public Entity Size/Number of Residents/Square Mileage:/3 |Q Event(s)Completed (include Name of Project/Event,Date of Event Start/Completion,Details on Size/Scope of Work/Complexity) Is the Contract still Active?Yes X No 45 of 92 23 333 REFERENCE #2 Event(s)Completed (include Name of Project/Event,Date of Event Start/Completion,Details on Size/Scope of Work/Complexity)l/\JC prO/idt Ongoing rOuC)hoI /6 A Ch 643 or d Oni7tw 1 ffsuc Stolenr . Is the Contract still Active?Yes No Contact Number &Email SCO'O (J Public Entity Size/Number of Residents/Square Mileage: Public Entity Name:(W Reference Contact Person/Title/Department:J LJ I C/Y 46 of 92 24 334 REFERENCE «3 Public Entity Name:| Reference Contact Person/Title/Dcpartment J Contact Number &Email ^0^~~7<~/C/'I cd^C’XOnani .org Public Entity Size/Number of Residents/Square Mileage: r>/<3. Evenl(s)Completed (include Name of Project/Event.Date of Event Start'Complction.Details on Size/Scope of Work/Complexity)Cl/f i I (/(J ftP)J61A I TO M CfHACff ar2JDO 5K ruft Is the Contract still Active?Yes No 47 of 92 25 335 REFERENCE #4 Public Entity Name:_Scan Reference Contact Person/Title/Department:JCCri Contact Number &Email JOho.Q COn Public Entity Size/Number of Residents/Square Mileage: n/Q . Event(s)Completed (include Name of Project/Event,Date of Event Start/Completion,Details on Size/Scope of Work/Complexity) in van pus I o cg-n cn^occ qC^o-n3 #uoCconcyv tdcq aboor- 30,000 XCf -fc-too, Is the Contract still Active?Yes /*y No 48 of 92 26 336 March 28'",2023 "To Whom It May Concern1' I a minting this letter to recommend the services of Florida Preferred Group.As the Safety Director for Citrus Health Network,I understand the essential role of janitorial services in the environment of care in a healthcare setting.Florida Preferred Group has delivered these crucial services to our facilities during the past three years. I am extremely satisfied with the way they conduct business and provide quality services. They remain compliant with industry standards.Their staff have demonstrated their qualifications to seize the job regardless of the challenge.The administrative staff is attentive, dedicated,determined to assist,and open to feedback. I welcome this opportunity to promote the services of Florida Preferred Group and in conclusion, and with the most certainty and without reserve,recommend their sen/ices. Kindly regards, Gisela Suarez Inpatient Adm inistrator/Safety Director Citrus Health Network,Inc. 27 337 14135 ST 32tHL Street H mriMteed,FT, fHTire:305.24*317(5 Fm;JQ5,?4*,3M9 I'ktndj'n llonirgro*lb FimhJ bank Jennifer Owi Florida Preferred Group March 21,2023 We have teen using Florida Preferred Group Cleaning services since My 2020.They hive great tuff that is professional,punctual and reliable and do a Rood job cleaning our facility.We can really on them when we need to reschedule or when we need additional sEtvices completed. Wc are very pieased with their service5 a nd would highly reHMnmend. Sincerely, Darlene Hingham Farm Share,Inc QWoey *JadtHMiTilie *PalaLki *111«Beaeh *Hrn>iind *Miami-ltailc *Fluridu Cilj Fahd Shim Jisadquarter Hr 1<I±»SW SOtli Street HtrnrrtenJ,H,33933 Otlim MS J!W>.327C fen 3&Ji6.tts4 rfciMbwMrg 28 338 Ll'Ve (i&Stila. CHILDHOOD CANCER FOUNDATION 1ST 201 3 To whom it may concern - On behalf of all of us at the Live Like Bella Childhood Cancer Foundation I would like to both thank and recommend Florida Preferred Group (FPG). FPG provides janitorial services at our headquarters in Coral Gables,FL and they take care of our office as of it were their own home. In addition,as a non-profit foundation,we are especially grateful for all they donate to us in-kind throughout the year. Getting to the office knowing that our space will always be immaculate is such a relief.We host meetings almost daily and everyone who visits always comments on how nice the office looks and you can tell it’s always handled with care. We really appreciate each of them and look forward to continuing our relationship with FPG formany years to come! If I can provide any additional information,please do not hesitate to contact me directly. Cordially,vfibv— Nicole de Lara Puente Chief Executive Officer Live Like Bella®Childhood Cancer Foundation Live Like Bella®Childhood Cancer Foundation |www.LiveLikeBella.org 2199 Ponce De Leon Blvd.Ste.303 Coral Gables,FL 33134 |(786)505-3914 |Info@LiveLikeBella.org The Live Like Bella®Childhood Cancer Foundation is committed to being an internationally recognized leader in childhood cancer research and advocacy while providing financial and emotional support to families whose children are battling cancer. 29 339 NDRTH’MIAMInWiWil PARKS AND RECREATION It Starts tn Parks! January 24,2024 Re:Letter of Recommendation Florida Preferred Group To whom it may concern, Florida Preferred Group (FPG)has been working with City of North Miami Parks &Recreation Department for over a year,during which time,I have gotten to know the workers and leadership team;and admire their sense of dedication and commitment towards our community. FPG has served as the sole cleaning and janitorial service provider for the Scott Galvin Community Center.As the Recreation Coordinator,directly in-charge of the facility,I mostly commend their dependability and attention to details.During which time,I have learned to rely on their mature level of responsibility and professionalism. As a Parks and Recreation Professional,with over 15 years of experience in facility management and public relation affairs,I can assure you that FPG is a top-notch organization.You will not be disappointed. I highly recommend! Should you have any further questions,please feel free to contact me at:305-895-9840 (Office)or via email at:agarcia@northmiamifl.gov AnthohyGarcia Recreation Coordinator Sincerely, 1600 NE 125 Street I North Miami I Florida I 33181 305.895.9840 30 340 CDR MAGUIRE To Whom It May Concern, I am writing this letter to highly recommend Florida Preferred Group (FPG)for their exceptional services in maintaining cleanliness and sanitation in CDR and ancillary facilities. FPG has been providing services to our organization since 2022 throughout the state of Florida.In addition to our corporate offices,FPG has supported CDR through our Health and Emergency Management divisions in activations for major disasters,such as Hurricane Ian and the recent Hurricane Debby.FPG provided janitorial services in Alternate Care Sites (temporary hospitals)and General Population Shelters in Southwest Florida during Hurricane Ian,and most recently cleaning services at the State Emergency Operations Center in Tallahassee during Hurricane Debby.Throughout this time,they have consistently demonstrated high levels of professionalism,reliability,and attention to detail.Their team of janitorial staff is thorough in their cleaning processes and always ensures that facilities are kept in pristine condition. We have been extremely satisfied with the quality of work provided by FPG.They have consistently exceeded our expectations and have shown flexibility in accommodating specific cleaning needs and schedules.Additionally,their responsiveness to any concerns or special requests has been commendable. I can confidently say that FPG has played a crucial role in helping us maintain clean and healthy environments for our staff,visitors,and clients.Their services have undoubtedly contributed to the overall success of our organization,and we are grateful for their dedication and hard work. I wholeheartedly recommend FPG to any organization seeking reliable and professional janitorial services.Their commitment to excellence and customer satisfaction truly sets them apart from other cleaning companies. Sincerely, Judith L.Ivester Business Development Coordinator CDR Maguire,Inc.,Emergency Management Division 11740 SW 80th St #102 Miami,FL 33183 *P 786 235.8534 •Fax 786.235.8501 WWW CDR-COMPANIES COM 31 341 "InorthImiami PARKS AND RECREATION January 26,2024 Re:Letter of Recommendation Florida Preferred Group To whom it may concern, I am writing this letter to highly recommend;Florida Preferred Group (FPG)for their exceptional services in maintaining the cleanliness at our Parks and Recreation facilities.I have had the pleasure of working closely with them for over a year and their commitment to excellence has truly impressed me! FPG has consistently demonstrated a thorough understanding of the unique cleaning needs of our facility (Scott Galvin Community Center).Their team is diligent,reliable,and goes above and beyond to ensure that our premises are not only cleaned but also well-maintained. One of the aspects that sets FPG apart is their attention to detail;they are proactive in identifying areas that require special attention and address them promptly.Their staff is well trained,professional,and always approach their work with a positive attitude.It is evident that they take pride in their work and are dedicated to creating a safe and hygienic environment for our patrons.Supervisors make periodical visits and are on top of our needs,which I specially appreciate. In addition to their exemplary cleaning services,FPG has also been responsive to any last minute special requests or concerns that we have raised.Their commitment to customer satisfaction is truly commendable,and it reflects in the positive feedback we have received from our facility users. I highly recommend! Should you have any further questions,please feel free to contact me at: 305-895-9840 (Office)305-467-3553 (Cell)or via email at:eramos@,northmiamifl.gov IBDO NE 126 Street I North Miami I Florida I 33181 305.895.8848 FORM 9 32 342 FORM 9 KEY STAFF &PROPOSED SUBCONTRACTORS KEY STAFF Please complete the following chart with the Firm’s proposed Key Staff.If additional space is required,please copy/duplica Name te this page and atta Title ch to this For Years of Experience m.Additio Years with Firm nal space:No Yes Licenses/Certifications went 4 &UC(IP 3 rwck aqm z wa.20 3 Please explain the Firm’s ability and resources to substitute personnel with equal or higher qualifications than the Key Staff they will substitute for w here substitute is required due to attrition, turnover,or a specific request by the City: TO Q(Zr 12V Ci^pJoqCC/ OJC Tinned pMf (turfs • 49 of 92 33 343 Please identify each Key Staff member’s engagement commitments that will exist concurrently with the City’s Services: Key Staff Name Area of Responsibility Client Commitment (Hours/week) Period of Engagement /2^y)Ail 3d Gau cwu /nn^acjcr £20 PROPOSED SUBCONTRACTORS The undersigned Proposer hereby designates,as follows,all major subcontractors whom they propose to utilize for the major areas of work for the services.The bidder is further notified that all subcontractors shall be properly licensed,bondable,and shall be required to furnish the City with a Certificate of Insurance in accordance with the contract general conditions.Failure to furnish this information shall be grounds for rejection of the bidder's proposal.(If no subcontractors are proposed,state “None”on first line below.) Subcontractor Name &Address Scope of Work License Number Firm:PrC/C/TCd 6 UP , A u t horized Signature:<)Date:i Print or Type Name:?T £1 QO I Title: 50 of 92 PROOF OF EXPERIENCE Founded in 2019, our company specializes exclusively in janitorial and commercial cleaning services, leveraging the expertise of a sister maintenance company with over 15 years of experience in delivering exceptional service. We are fully committed to delivering high-quality cleaning solutions, drawing on our extensive background in serving government agencies and organizations of similar size and scope, particularly in South Florida. With over a decade of experience in the industry, and five years under our current business name, we are fully equipped to meet the needs of the City and provide tailored cleaning services to suit your specifications. Our team possesses a deep understanding of business operations and legal requirements, ensuring compliance and reliability. This includes: 1. Compliance with Legal and Safety Standards: ○ Full adherence to OSHA regulations, including bloodborne pathogen protocols and workplace safety requirements. ○ Strict compliance with local, state, and federal labor laws governing employment and service provision. ○ Responsible handling and disposal of cleaning chemicals in line with environmental regulations. 2. Expertise in Business Operations: ○ Development of tailored cleaning plans that align with municipal requirements and operational schedules. ○ Robust quality control programs with regular inspections, client feedback mechanisms, and performance assessments. ○ Efficient resource allocation and scheduling to maintain uninterrupted service during peak usage or special events. 3. Training and Certification: ○ Staff trained in industry best practices, advanced cleaning technologies, and customer service protocols. ○ Certifications in eco-friendly and sustainable cleaning practices to reduce environmental impact. The following attachments outline our business operations and procedures. 34 344 Inspection Software: FPG uses a Quality Control Software named “Orange QC”. Program Objectives: ● Ensure that all employees have the knowledge to perform their job ● Ensure that all employees are following company protocol and obeying by the cleaning tasks ● Improved team work This software allows the FPG Quality Control Officer to: ● Perform routine inspections right from his tablet ● Monitor account performances & send real time alerts based on triggers you set ● Generate reports for clients How it works: If anything, other than a “Satisfactory” is entered, the system will provide a report suggesting actions to be taken. The end user is to: A. Refer to a supervisor B. Immediate Action Required C. High Risk (hazardous situations to health or safety) The report will show all satisfactory areas and that are in need of attention. A ticket is then issued to the supervisor and/or manager in charge. They are responsible to communicate a copy of the report to the cleaners so that they are able to address all concerns and clear the ticket within 48 hours. FPG’s Hiring Procedures E-Verify protects jobs for authorized workers and helps employers maintain a legal workforce. Key Benefits of using the E-Verify system include: ● Helping employees maintain a legal workforce ● Virtually eliminating Social Security ● Improving the accuracy of wage and tax reporting FPG runs background checks for all employees. 35 345 ORANGEQC Ttiis Organization Participates in E-Verify *«w.dhi.der C-turd* Background checks include: - Criminal History Search - Violent Sexual Offender Registry Search - DMV Records - Florida HRS Abuse Registry FPG uses a time tracking application named “ADP”. Program Objectives: ADP is one of the biggest providers of human resources (HR) software solutions and outsourced services in the world offering services such as: ● Payroll and tax ● HR management ● Time and labor ● Benefits Mobile Time Tracking App – GEO locations ADP Logs employee clock in/out times based on a perimeter/boundary around a particular location on a map. MICROFIBER TECHNOLOGY: Yellow Glass Cleaning Red Restroom Cleaning Blue General Cleaning 36 346 «0 S' rprcGifd v a / Tune for Quick Clock Clock F *aaxour ] SAFETY COMPLIANCE & SDS DOCUMENTATION: In compliance with OSHA safety regulations, Florida Preferred Group ensures that a comprehensive Safety Data Sheet (SDS) book is maintained in every janitorial closet at each serviced facility. This SDS book contains detailed information about all cleaning products used on-site, including their proper handling, storage, and emergency procedures. UNIFORM: FPG is aware of the value an appropriately recognized employee can add to a workplace. For this reason, FPG offers professional and identifiable uniform. Housekeepers wear grey polo shirts with our logo plainly visible in the front. FPG also provides an identification card to every employee that is required to carry with them at all times during work hours. FPG is aware of the need of having all workers identified. We want to make sure that your guests feel secure and are always aware of who is working nearby. EMPLOYEE ID’s: 37 347 Jennifer Oves President Employee ID :1 986 One of the government agencies we have had the honor of servicing is Scott Galvin, City of North Miami. Below, we provide a detailed inspection of our work at Scott Galvin, highlighting our proven track record and commitment to excellence: 38 348 #11897470 JANITORIAL INSPECTION Location:SCOTT GALVIN (NORTH MIAMI) Inspector:Yaima Ramayo Completed:2024-12-26 11:44am Score:95% Florida Preferred Group Line Item Rating Score ENTRANCES &LOBBY AREA:Above Average 95% P ENTRANCES &LOBBY AREA : ENTRANCES: 1.The glass of the entrances doors looks clean,no hands or fingers marks were found. 2.Automatic Doors tracks look clean,no debris was found. 3.The trash can at the entrance looks clean and is empty. 4.Doors frames are being properly cleaned,no stains were found. 5.Event entrance doors ore properly cleaned. 4.Main entrance no spiderwebs were found. 5.Side entrance is being properly cleaned. LOBBY AREA: 1.Floors are being cleaned properly.2.Swept and mopped correctly.3.Under the chairs look clean,no debris or dust was found. 4.Behind reception desk is clean. 5.Hallway corners and edges are properly cleaned. 6.Lobby area behind the plants look clean,no debris was found. 7.Reception desk is clean.8.Waiting area is being cleaned properly. 9.Under the bench are clean,dust free. 10.Trash and recycling containers are clean and empty. PHOTOS ATTACHED. io Line Item Rating KITCHEN AREA &BREAK ROOM : Q KITCHEN AREA &BREAK ROOM : 1.Floors are swept and mopped correctly. 2.Chairs and table are clean. 3.Table and chairs are being properly cleaned. 4.No marks were found in the cabinet doors. 5.Top of refrigerator have no dust. 6.Stainless steel sink look clean and shine. 7.Countertop look clean. 8.No debris found under the table. 9.Trash container is clean. 10.Behind the trash container is clean. 11.The top of the information board is clean. PHOTOS ATTACHED. IT 21 Score 95% 28 Line Item PCARPETS &FLOORS: CARPETS: 1.Entrances black rug are being properly vacuumed. 2.Conference room are being cleaned and maintained correctly.3.Office carpet is properly maintained. 4.Behind the office doors are clean,free of dust. FLOORS: 1.Lobby area are being swept and mopped properly.2.First floor hallways look clean,corners and edges dust free. 3.Second floor elevator lobby is clean. 4.Second and Third floor hallways are being properly maintained,have no dust. 5.Bathrooms floor are clean. 6.Second floor behind reception desk floor are clean. 7.Corners and edges no debris was found. 8.Elevator floors are clean. 9.Gym floors are clean. PHOTOS ATTACHED. Rating Score PREVIOUS PROJECTS 1. CDR Health ● Scope of Work: Cleaning of facilities and offices located in Doral, Tampa and Tallahassee, Florida. ● Special Engagement: Worked collaboratively during Hurricane Milton (October 2024–November 2024), providing cleaning relief in shelters in St. Petersburg, Jacksonville, Tampa, Wesley Chapel, and Auburndale. ● Contract Period: August 2024 – Present ● Client Contact: Jacquline Perez, 305-336-5650 - jacqueline.perez@cdrmaguire.com ● Proof of Completion: Attached Quality Control (QC) cleaning reports for Doral and Tallahassee offices. CDR DORAL: 39 349 #11941472 JANITORIAL INSPECTION Location:CDR HEALTH (DORAL) Inspector:Yaima Ramayo Completed:2025-01-08 3:14pm Score:96% Florida Preferred Group Line Item Rating Score ENTRANCES &LOBBY AREA:Above Average 95% P ENTRANCES &LOBBY AREA : ENTRANCES: 1.The trash cans are emptied daily. 2.Entrance free of spiderwebs. 3.No debris was found. 4.Glass doors are properly cleaned,no hands marks were found. LOBBY AREA . 1.Floor is properly cleaned are being swept and mopped correctly. 2.Under the chairs no debris was found. 3.Reception desk surfaces look clean. 4.Waiting areas chairs are being properly cleaned and organized. 5.Carpets are properly vacuumed. 6.Second floor (Suite It 11 &12 )reception desks surfaces are property cleaned. Photos attached. Line Item Rating 68 CARPETS &FLOORS: PCARPETS &FLOORS : CARPETS: 1.Waiting areas carpets are being properly vacuumed. 2.Exam rooms are vacuumed daily. 3.Offices behind the doors are clean. 4.Hallways carpets are vacuumed correctly. 5.Restrooms carpet is clean. FLOORS: Above Average 1.Swept and mopped properly on lab floor. 2.Kitchen floor are being properly maintained,no debris was found. 3.Restrooms floors look clean,corners and edges free of debris. Photos attached. Score 95% 95% 40 350 Line Item Rating 102 103 104 105 106 107 108 109 110 BASEBOARDS &WALLS: P BASEBOARDS &WALLS : BASEBOARDS: 1.Firstand Second floor hallways baseboards are being cleaned property. 2.Columns baseboards have no dust. 3.Waiting areas (first and second floor)behind the chairs baseboards are clean. 4.Managers offices have no dust. 5.Firstand Second floors exam rooms dust free. 6.Behind the doors dust free. 7.Kitchen baseboards are clean. 8.Restrooms baseboards are clean. WALLS: 1.Exam rooms walls behind trash cans are clean. 2.Hallways walls look clean,(in some areas stains were found but they do not come out). 3.Lab is property cleaned. 4.No stains were found in the exam rooms walls. 5.Walls behind the doors are properly cleaned. 6.Second floor elevator lobby walls are being cleaned properly,no stains were found. 7.Kitchen walls look good and clean. 8.Restrooms walls are clean. Above Average Score 95% Line Item Rating 176 177 178 179 180 ELEVATORS : P ELEVATORS: 1.Elevator tracks look clean,no debris was found. 2.Floor is properly cleaned,swept and mapped correctly. 3.Interior door properly cleaned. 4.Light fixtures dust free. S.Handrail is clean. 6.Walls look clean,no marks were found. Photos attached. 181 182 183 Above Average 184 185 Score 95% Photos attached. CDR TALLAHASSEE: 41 351 #11550947 JANITORIAL INSPECTION Location:CDR HEALTH (TALLAHASSEE ) Inspector:Yaima Ramayo Completed:2024-10-12 10:43pm Score:95% Florida Preferred Group Line Item ENTRANCES &LOBBY AREA : PENTRANCES &LOBBY: 1.Carpet is vacuumed and cleaned properly. 2.Glass doors look clean,are properly cleaned,no hands marks werefound. 3.No cobwebs were found. 4.The entrance is swept. 5.Entrances sidewalks look good and clean, LOBBY AREA . Rating Above Average 1.Floors are being swept and mopped properly. 2.Corners and edges look good and clean. 3.All surfaces are being properly cleaned. 4.Magazine table is clean and organized. S.Desk and chairs are clean and dust free. 6.Couches are clean and organized. 7.Under the couches no debris was found. 8.Reception desk is clean. 9.Chairs legs look good and clean,dust free. Photos attached. Score 95% B 9 10 42 352 Line Item Rating 90 91 92 93 RESTROOMS (LADIES AND MEN’S BATHROOMS ) PLADIES AND MEN’S BATHROOMS : 1.Toilet papers dispenser dust free. 2.Handrail are clean. 3.Mirrors no water marks were found. 4.Sinks look good and clean. S.Countertop are properly cleaned. 6.Behind the toilets no debris was found. 7.Toilets are properly cleaned. 8.Papers towels dispenser are clean and property refilled. 9.Corners and edges look clean,no debris was found. 10.Swept and mopped correctly. 11.Toilets base no stains were found. 12.Trash can cover is clean. Photos attached. Above Average Score 95% 94 95 96 97 96 Line Item Rating 99 100 101 102 103 109 110 111 112 108 EMERGENCY STAIRWELLS: PEMERGENCY STAIRWELLS: 1.No spiderwebs were found. 2.Steps are being properly cleaned. 3.Handrails are clean,no hands marks found. Above Average 113 ELEVATORS: PELEVATORS: 1.Elevator track look good and clean,no debris was found. 2.Floor is being swept and mopped properly. 3.Handrails are clean,no stains were found. 4.Buttons panel look clean and shine,no hands marks were found. 5.Stainless steel walls are properly cleaned. 6.Exterior and interior stainless steel doors are properly cleaned. Above Average Line Item Rating Score 119 120 121 122 123 PARKING LOT &GARAGE: P PARKING LOT&GARAGE: N/A Above Average 95% OFFICES /CLASSROOMS &CONFERENCE ROOM: POFFICES /CLASSROOMS /TRAINING ROOM AND LAB : OFFICES: L Are properly vacuumed. 2.Desk are clean. 3.Chairs legs no dust was found. 4.Behind the computers there is no dust CLASSROOMS/TRAINING ROOM . 1.Carpet are properly vacuumed. 2.Chairs are clean and organized. 3.No finger marks were found on the table LABS: 1.Floors Swept and mopped correctly. 2.Stainless steel tables are properly cleaned. 3.Sink are properly cleaned. 4.Countertop look clean. 5.Cabinets doors are properly cleaned. 6.Exam tables are being property cleaned,no dust was found. 7.Exams rooms equipments have no dust Photos attached. Above Average 95% Score 95% 95% 2. Doodie Calls ● Scope of Work: Emergency janitorial services for areas affected by Hurricanes Debby, Milton, and Helene, providing cleanup in emergency-affected regions across the state of Florida. ● Contract Period: August 2024 – January 2025. ● Client Contact: Jackie Gross, 941-233-4673 - jackie@doodie-calls.com ● Proof of Completion: Documentation of emergency response service engagements and relevant cleaning reports for impacted areas. 43 353 DOODIE CALLS Emergency Services Restroom Cleaning -Stop 3 Friday,January 10,2025 10 Issues Identified ISSUE 1 ISSUE 5 ISSUE 6 ISSUE 7 3. Lexus/Toyota ● Scope of Work: Ongoing daily cleaning services for all departments during business hours (Sales, Service, etc.) at 8 locations, including Kendall Toyota, Lexus of Kendall, Toyota of West Kendall and Lexus of West Kendall. ● Contract Period: Ongoing since August 2020.. ● Client Contact: John Alvarez, 305-778-4064 - john.alvarez@beanauto.com ● Proof of Completion: Attached Quality Control (QC) reports for daily services, confirming consistent service delivery and client satisfaction. LEXUS WEST SERVICE: 44 354 #11852355 JANITORIAL INSPECTION Location:LEXUS WEST (SERVICE) Inspector Yaima Ramayo Completed:2024-12-13 1:54pm Score:96% Florida Preferred Group PENTRANCES &LOBBY AREA . Line Item Rating Score ENTRANCES &LOBBY AREA:Above Average 95% ENTRANCES: 1.Entrances no debris was found,look clean. 2.No hands marks were found on glass doors entrances. 3.No spiderwebs were found. 4.No debris was found on doors tracks. 5.No stains were found on aluminum doors frames. LOBBY AREA: 1.Swept and mopped properly. 2.Coffee tables are being properly cleaned. 3.Leather couches are clean and organized. 4.Under couches no debris found. 5.Corners and edges no dust found. 6.Customer service desk surface dust free. Photos attached. 1 2 3 4 5 6 7 8 9 10 45 355 Score Line Item Rating Score 49 CARPETS &FLOORS: PCARPETS &FLOORS : CARPETS: 1.Side entrance black mat are properly vacuumed. 2.Black rug coffee station are being vacuumed properly. 3.Entrances rug with logo are being properly vacuumed. FLOORS: 1.Parts accessories look clean. 2.Customer service desk swept and mopped correctly. 3.Entrances properly cleaned. 4.Customer waiting area are being cleaned properly. 5.Under the couches no debris was found. 6.Internet access is properly maintained,dustfree. 7.Kid zone comers and edges look clean. Photos attached. Exceptional L00% Line Item A/C VENTS &VENTILATION GRILL : PA/C VENTS &VENTILATION GRILL : 1.Coffee station vents are clean,no dust found. 2.Internet access A/C vents have no dust. 3.Restrooms vents no dust was found. 4.Kid zone look good and properly cleaned. Photos attached. Rating Above Average Score 95% 64 69 66 WINDOW SILLS &BLINDS: PWINDOWSILLS &BLINDS : 1.Exterior window sills are being properly cleaned. 2.Windowsills behind the leather couches have no dust. 3.Kid zone aluminum window sills are clean,no dust found. 4.Customer waiting area upper window sills look good and clean,have no dust. 5.Waiting area blinds are properly maintained,no dust found. 6.Empty offices dust free. Photos attached. Above Average 95% 79 eo ai BASEBOARDS &WALLS: QBASEBOARDS &WALLS : Above Average BASEBOARDS: L No dust found on Kid zone baseboards. 2.Internet access rooms are clean. 3.PartAccessoires area baseboards are clean. 4.Kid zone dustfree. 5.Under stainless steel water fountain baseboards have no dust. WALLS: 1.Kid zone is clean,some stains don't come out 2 Internet access rooms many stains have,don’t come off. 3.Next to coffee station wall are clean. 4.Restrooms walls look clean,no hands marks were found. Photos attached. 95% 64 es 66 a?ee 46 356 Line Item Rating Score RESTROOMS (LADIES AND MEN’S BATHROOMS ) PRESTROOMS (LADIES AND MEN S BATHROOMS). 1.Corners and edges no debris found. 2.Swept and mopped correctly. 3.Countertops no stains were found. 4.Large mirrors are being properly maintained. 5.Behind the toilets is clean. 6.Toilets base no stains were found. 7.Handrails have no dust 8.Sinks look clean,they are properly maintained. 9.Toilet paper dispenser dust free and properly refilled. 10.Top of restrooms partitions dust free. 11.Stalls look clean,no hands marks were found. 12.Changing tables are being properly cleaned,no stains found. 13.White pipes under the sink no have dust 14.The partitions are dust free. IS.Urinal partitions are properly cleaned. 16.Noyellow stains was found under the urinals,look very clean. Photos attached Exceptional 101 100% Line Item Rating Score POFFICES /CLASSROOMS &CONFERENCE ROOM: OFFICES: N/A. CLASSROOMS: N/A CONFERENCE ROOM :N/A KITZONE: 1.Kid zone look clean 2.TV display are properly cleaned,have no dust. 3.The table and chairs are clean. 4.Corners and edges no debris was found. 5.Floors are swept and mopped correctly. Photos attached. 123 124 125 126 127 126 129 130 COMMENTS: COMMENTS: N/A SUGGESTIONS SUGGESTIONS: N/A. QUALITY CONTROL &SAFETY MANAGER PQUALITY CONTROL &SAFETY MANAGER: YAIMARAMAYO. Line Item Rating Score 106 107 108 109 110 EMERGENCY STAIRWELLS : PEMERGENCY STAIRWELLS : N/A. Above Average 95% ELEVATORS: ELEVATORS: N/A. PARKING LOT &GARAGE: PPARKING LOT &GARAGE: N/A. OFFICES /CLASSROOMS &CONFERENCE ROOM : Above Average Above Average Above Average 95% 95% 95% PROPOSER’S QUALIFICATIONS JENNIFER FRANCO OVES Project Manager 3806 SW 148th Ave, Miami, FL 33185 • (786) 838-8029 • JenniferOves19@gmail.com PROFESSIONAL EXPERIENCE Mrs. Oves has over 21 years of administrative and management experience in the private sector that includes supervising, planning and coordinating. While Mrs. Oves is able to apply prior knowledge and social skills throughout the company. She has proven herself by growing the company to provide services throughout the state of Florida and Georgia. She is present in her company and has clear communication with her team. She implements new techniques to help the team work efficiently and is open to changes when needed. Ms. Oves wore all the hats when the company was first opened, which made her fully aware of the different roles performed throughout the company. CEO & Founder Florida Preferred Group 2020-current • Managing a team of 100+ individuals • Recruiting and Onboarding • Training and coordinating continuing education • Overseeing all operations and ensuring that the team is executing all requirements • All payroll functions • Accounts payable and receivables • Scheduling site visits • Initial client interview • Preparing contracts and customized cleaning schedules • All social media platforms • Emergency Management Services Lead Administrative Assistant/Paralegal Law Offices of Corredor, Husseini & Snedaker, P.A., Miami, FL, 2005 – 2020 Actively supporting a team of attorneys with litigation and real estate experience. Responsible for managing a high volume of civil litigation cases • Managing calendar for 5 attorneys including 2 partners • Filing and maintaining of personal injury lawsuits • Supervising the assistants to confirm they are working efficiently and effectively • Conducting calendar meetings once a month • Scheduling and confirming all operations including depositions, hearings, mediations, independent medical examinations and examination under oaths • Preparation of correspondence, affidavits, motions and pleadings • Negotiation and settlement of cases 47 357 • Review of cases to provide clients with the status and closing files • Managing office supplies inventory control • Organizing events such as Christmas Party, Real Estate meetings and Annual Anniversary Functions (Including hotel booking, cruise planning and organizing tours) • Preparing checks and disbursing payments to clients and vendors • Scheduling interviews and assisting with the hiring process • Coordinating travel arrangement for attorneys Part-Time Travel Consultant Exquisite Vacations, Inc 2013 - 2015 • Assisting customers with their travel needs • Handling of calls and responding accordingly • Making reservations for hotels, flights, cruises and car rentals • Coordinating and negotiating with tour planners regarding rates, time and date • Preparing invoices and processing payments EDUCATION Miami Dade College, Miami, FL Bachelor of Applied Science in Supervision and Management Dec 2014 Associate of Arts 2010 University of Miami, Miami, FL Paralegal Certificate June 2009 State of Florida Notary Public KEY SKILLS • Microsoft Word (Excel, Outlook, Power Point), Adobe Acrobat, Time Matters, ADP RUN, ADP Workforce, Orange QC, Quickbooks, LexisNexis and West Law • Fluent in English and Spanish 48 358 TRAINING * CERTIFICATE OF COMPLETION This certifies that Jennifer Oves is awarded this certificate for OSHA 10 Hour Outreach Training Program -General Industry Credit Hours 10.00 Completion Date 04/26/2020 Curtis Chambers.Trainer C 28-0106073 and G 26-0079775 'As an OSHA authorized trainer.I verify that I have conducted this OSHA outreach training class in accordance with OSHAOutreachTrainingProgramrequirements.!will document this class to my authorizing OSHA training organization. Upon successful review of my documentation,Iwill provide each student their completion card within 90 days of the end of the class.’ THIS CERTIFICATE IS NON-TRANSFERABLE 6801 N Capital of Texas Hwy.Bldg1,Suite 250 I Austin,TX 78731 I 877.881.2235 I www.360training.com SERVICE AND INCORPORATION 49 359 State of Florida Department of State I certify from the records of this office that FLORIDA PREFERRED GROUP, LLC is a limited liability company organized under the laws of the State of Florida,filed on October 29,2019,effective October 28,2019. The document number of this limited liability company is LI 9000270086. I further certify that said limited liability company has paid all fees due this office through December 31,2024,that its most recent annual report was filed on January 29,2024,and that its status is active. Given under my hand and the Great Seal of the State of Florida at Tallahassee,the Capital,this the Twenty-ninth day of January, 2024 Secretary of State Tracking Number:7487202979CC To authenticate this certificate,visit the following site,enter this number,and then follow the instructions displayed. https://services.sunbiz.org/Filings/CertificateOfStatus/CertificateAuthentication 50 360 Electronic Articles of OrganizationForFloridaLimitedLiabilityCompany L19000270086FILED8:00 AMOctober29,2019Sec.Of Statejsdennis Article I The name of the Limited Liability Company is: FLORIDA PREFERRED GROUP,LLC Article II The street address of the principal office of the Limited Liability Company is: 2449 SW 153 PASS MIAMI,FL.33185 The mailing address of the Limited Liability Company is: 2449 SW 153 PASS MIAMI,FL.33185 Article III The name and Florida street address of the registered agent is: JENNIFER OVES2499SW153PASS MIAMI,FL.33185 Having been named as registered agent and to accept service of process for the above stated limitedliabilitycompanyattheplacedesignatedinthiscertificate,I hereby accept the appointment as registeredagentandagreetoactinthiscapacity.I further agree to comply with the provisions of all statutesrelatingtotheproperandcompleteperformanceofmyduties,and I am familiar with and accept theobligationsofmypositionasregisteredagent. Registered Agent Signature:JENNIFER OVES 51 361 Article IV The name and address of person(s)authorized to manage LLC: Title:MGRLICETTEA RODRIGUEZ P.O.BOX 771566MIAMI,FL.33177 L19000270086FILED8:00 AMOctober29,2019Sec.Of Statejsdennis Article V The effective date for this Limited Liability Company shall be: 10/28/2019 Signature of member or an authorized representative Electronic Signature:JENNIFER OVES I am tire member or authorized representative submitting these Articles of Organization and affirm that thefactsstatedhereinaretrue.I am aware that false information submitted in a document to the DepartmentofStateconstitutesathirddegreefelonyasprovidedforins.817.155,F.S.I understand the requirement tofileanannualreportbetweenJanuary1standMay1stinthecalendaryearfollowingformationoftheLLC and every year thereafter to maintain "active"status. LICENSES CERTIFICATES 52 362 Local Business Tax Receipt Miami-Dade County,State of Florida -THIS IS NOT A BILL -DO NOT PAY RECEIPT NO.7293134 BUSINESS NAMEILOCATON FLORIDA PREFERRED GROUP LLC OPERATING IN DADE COUNTY OWNER FLORIDA PREFERRED GROUP LLC QO JENNIFER OVES.MGR ETnployee(s)1 RENEWAL 7582551 SEC.TYPE OF BUSINESS 213 SERVICE BUSINESS lbt EXPIRESSEPTEMBER30,2025 Must be displayed at place of businem Pursuant to County Code Chapter CA -Art.B a 10 PAYMENT RECEIVED BY TAX COLLECTOR 75.00 07/16/2024 INT-24-43365B Thia Local Bus in bhb Ta*R bc el pt only confirms payment of the Inos I BusinassTsx.The fiscs ipt la net a:license., parnut or a eartifiutiM of tha hsIdBr's qualiUtaii bus,ta dobutinoas.Hold bi must comply with any qm mm ental cr n onpovornmental raju lata ry lews and requirnm anto which apply to th e b usi ana. The H EC El PT NO.abets must be itlop layad an s II sommerc la I nhkl«o -Miam H)s de Cods Sec (a-27S. For more inFermatio n,visit www.Tjriomids da javftaxcol Iseler 53 363 Woman &Minority Business Certification FLORIDA PREFERRED GROUP,LLC ROfflOA DEWHEKT Of MAMASEHENT SBMCES £§•SUPPLIER DEVELOPMENT Is certified under the provisions of 287 and 295.187,Florida Statutes,for a period from: 08/29/2023 08/29/2025 Florida Department of Management Services Office of Supplier Development 4050 Esplanade Way,Suite 380 Tallahassee,Florida 32399 850-487-0915 www.dms.myflorida.com/osd Better Business Bureau® Serving Southeast Florida and the Caribbean BBB Florida Preferred Group,LLC Valid Through ACCREDITED BUSINESS July 2025 This organization has demonstrated that it meets BBB Standards of Trust and commits to uphold the mission,services and standards of ethical business practices needed for BBB Accreditation. PERSONNEL QUALIFICATIONS/KEY STAFF 54 364 FORM 9 KEY STAFF &PROPOSED SUBCONTRACTORS KEY STAFF Please complete the following chart with the Firm’s proposed Key Staff.If additional space is required,please copy/duplica Name te this page and atta Title ch to this For Years of Experience m.Additio Years with Firm nal space:No Yes Licenses/Certifications way 4 19 2) Pi ZqiMrafc rnpyYiqrS 20 3 Please explain the Firm’s ability and resources to substitute personnel with equal or higher qualifications than the Key Staff they will substitute for w here substitute is required due to attrition, turnover,or a specific request by the City:w tbrpm/120 pnOCrdUzYZ . 49 of 92 55 365 Please identify each Key Staff member’s engagement commitments that will exist concurrently with the City’s Services: Key Staff Name Area of Responsibility Client Commitment (Hours/week) Period of Engagement Ail 3^ 6 20 PROPOSED SUBCONTRACTORS The undersigned Proposer hereby designates,as follows,all major subcontractors whom they propose to utilize for the major areas of work for the services.The bidder is further notified that all subcontractors shall be properly licensed,bondable,and shall be required to furnish the City with a Certificate of Insurance in accordance with the contract general conditions.Failure to furnish this information shall be grounds for rejection of the bidder’s proposal.(If no subcontractors are proposed,state “None"on first line below.) Subcontractor Name &Address Scope of Work License Number Firm:FiOldA ^0/1001 6 0)UQ ,L^C Authorized Signature:r T Date:I Print or Type Name:£1 QO (-Title:C tfD 50 of 92 56 366 Yaima Ramayo Rosabel 2001 SW 67th Avenue Apt 542 Miami,FL 33155 (786)881-3604 Yaimaramavo2003(8>qmail.com EXPERIENCES 2013-2022 Manager of hotel and catering services a social medical establishment 2018 Manager of housekeeping at residence for the elderly foundation les Bruyeres 2018 Manager of housekeeping at residence for the elderly foundation les Chataigniers 2018 Manager of housekeeping at hotel Beau Rivage 2012 Housekeeper at Espace de Vie Housekeeper at Residence for elderly de Drize 2009-2012 Housekeeper at Hotel d’Angleterre 2008 Housekeeper at SADAAKAH 2007 Housekeeper at hotel La Cigogne 2007 Housekeeper at hotel Crown Plaza Geneva TRAINING 2018 Professional practice training certificate (AFP) 2018 Certificate of fire witness 2020 Stewardship manager.Federal certificate of capacity 2017 Certificate of Cleaning and arrangement of premises and equipment 2019 Certificate Execution of administrative work 2019 Self health promotion and client support 2016 Certificate of Ergomotricity 2019 Standard precautions:protecting yourself and others 2022 Workplace Safety and Health Certifications Issued by OSHA•Hazard Communication (Emergency Action Plan)•Bloodborne Pathogens•Fire Safety•Ergonomics•Electrical Safety•Slip,Trip,and Fall Prevention•Hand Hygiene•Heat Stress•Personal Protective Equipment (PPE)•Workplace Safety•Carbon Monoxide Awareness 57 367 MG MINDRAGUIZ GONZALEZ min dr v68 @gmail .com 786 244 1760 Hialeah,Florida 33014 SUMMARY Motivational leader and organizational problem-solver with advanced supervisory, team building and customer service skills.Experience stepping into roles and quickly making positive changes to drive company success.Focused on using training, monitoring and morale-building techniques to maximize employee engagement and performance.Talented Human Resources Manager driven to address policy implantation and change management with creative and innovative approach.Strong understanding of evolving industry and maker demands.Offers 7 years of expertise in benefits administration,compensation structuring and recruitment. SKILLS. •Onboarding and Orientation. Technical Proficiency. Recruitment and Selection. •Thaining and Development. •Cost Control Performance Tracking and Evaluation. •Managing Operations and Efficiency. •Hiring and Thaining •Team Building. •Budget Management. •Employee Coaching and Motivation. •Performance Evaluations. •Project Planning. Complex Problem Solving. •Goal Setting. •Documentation and Reporting. Scheduling and Coordinating. •Verbal and Written Communication. Employee Development. •Team Leadership. •Business Development. •Shift Scheduling. •Decision Making. •MS Office. •Computer Skills. •Time Management. •Inter-Department Collaboration. •Human Resources Management. •Calm under Pressure. •Strategic Planning. •Interpersonal Relations. •Business Analysis and Reporting. •Professional and Courteous. •Customer Relationship Management. •P&L Oversight. •Negotiation and Conflict Resolution. •Customer Service. •Native Spanish. •Intermediate English language. •Advance Catalan language. Alllservice (Florida,United State)09/2021 Manager ORGANIZATIONAL CHART 58 368 INSURANCE CERTIFICATES 59 369 CERTIFICATE OF LIABILITY INSURANCE COVERAGES CERTIFICATE NUMBER:REVISION NUMBER: CERTIFICATE HOLDER CANCELLATION ACORD 25 (2016/03) DATE (MM/DD/YYYY) 01/22/2025 ©1988-2015 ACORD CORPORATION.All rights reserved. The ACORD name and logo are registered marks of ACORD ACORD THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER.THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND,EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW.THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S),AUTHORIZED REPRESENTATIVE OR PRODUCER,AND THE CERTIFICATE HOLDER. IMPORTANT:If the certificate holder is an ADDITIONAL INSURED,the policy(ies)must have ADDITIONAL INSURED provisions or be endorsed. If SUBROGATION IS WAIVED,subject to the terms and conditions of the policy,certain policies may require an endorsement.A statement on this certificate does not confer rights to the certificate holder in lieu of such endorsement(s). PRODUCER Real Insurance Agency Corp n?me-CT mike Ia/cIIo.Extl:(305)264-8536 Kk.No>:(305)264-6732 1400 SW 67 Ave Miami FL 33144 address:Michael.fernandez026@gmail.eom INSURER(S)AFFORDING COVERAGE NAIC# insurer A :KINSALE INSURANCE CO INSURED FLORIDA PREFERRED GROUP LLC INSURER B : INSURER C : 3806 SW148 AVE INSURER D: INSURER E : Miami FL 33185 INSURER F: THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIOD INDICATED.NOTWITHSTANDING ANY REQUIREMENT,TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN,THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS, EXCLUSIONS AND CONDITIONS OF SUCH POLICIES.LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. INSRLTR TYPE OF INSURANCE ADDL INSD SUBR WVD POLICY NUMBER POLICY EFF(MM/DD/YYYY) POLICY EXP(MM/DD/YYYY)LIMITS A X COMMERCIAL GENERAL LIABILITY CLAIMS-MADE X OCCUR Y Y 0100253620-01 08/09/2024 08/09/2025 EACH OCCURRENCE $1,000,000 DAMAGE TO RENTED .nn nnnPREMISES(Ea occurrence)$1UU.UUU MED EXP (Any one person)$5,000 PERSONAL &ADV INJURY $1,000,000 GEhJ'L AGGREGATE LIMIT APPLIES PER: POLICY X je°t X |LOC OTHER: GENERAL AGGREGATE $2,000,000 PRODUCTS -COMP/OP AGG $2,000,000 $ AUTOMOBILE LIABILITY COMBINED SINGLE LIMIT $(Ea accident) ANY AUTO BODILY INJURY (Per person)$ OWNEDAUTOSONLY HIREDAUTOS ONLY SCHEDULEDAUTOSNON-OWNED AUTOS ONLY BODILY INJURY (Per accident)$ PROPERTY DAMAGE $(Per accident)41 $ UMBRELLA LIAB EXCESS LIAB OCCUR CLAIMS-MADE EACH OCCURRENCE $ AGGREGATE $ DED RETENTION $$ WORKERS COMPENSATION AND EMPLOYERS'LIABILITY Y /NANYPROPRIETOR/PARTNER/EXECUTIVE OFFICER/MEMBER EXCLUDED? (Mandatory in NH) If yes,describe under DESCRIPTION OF OPERATIONS below N/A 1 PER OTH-STATUTE ER E.L EACH ACCIDENT $ E.L.DISEASE -EA EMPLOYEE $ E.L.DISEASE -POLICY LIMIT $ DESCRIPTION OF OPERATIONS /LOCATIONS /VEHICLES (ACORD 101,Additional Remarks Schedule,may be attached if more space is required) JANITORIAL SERVICES CERTIFICATE HOLDER IS LISTED AS ADDITIONAL INSURED. CITY OF SOUTH MIAMI SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF,NOTICE WILL BE DELIVERED IN ACCORDANCE WITH THE POLICY PROVISIONS. 6130 Sunset Drive AUTHORIZED REPRESENTATIVE South Miami,Florida 33143 _ 60 370 ACORl)CERTIFICATE OF LIABILITY INSURANCE DESCRIPTION OF OPERATIONS <LOCATIONS /VEHICLES (ACORD 101.Additional Ren\arX8 Schedule,may he attached li mere apace is requiredi CERTIFICATE HOLDER CANCELLATION ACORD 25 (2016/03) THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIOD INDICATED.NOTWITHSTANDING ANY REQUIREMENT,TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN.THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS. EXCLUSIONS AND CONDITIONS OF SUCH POLICIES.LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. DATE (MM’DD/YYYY) 01/21/2025 ©1988-2015 ACORD CORPORATION.All rights reserved. The ACORD name and logo are registered marks of ACORD THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER.THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND,EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW.THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S),AUTHORIZED REPRESENTATIVE OR PRODUCER,AND THE CERTIFICATE HOLDER. IMPORTANT:If the certificate holder is an ADDITIONAL INSURED,the policy(ies)must have ADDITIONAL INSURED provisions or be endorsed. If SUBROGATION IS WAIVED,subject to the terms and conditions of the policy,certain policies may require an endorsement.A statement on this certificate does not confer rights to the certificate holder in lieu of such endorsement(s). PRODUCER name Automatic Data Processing Insurance Agency.Inc. Automatic Data Processing Insurance Agency.Inc.1-800-524-7024 E-MAILADDRESS: 1 Adp Boulevard HSURER(S)AFFORDING COVERAGE NAIC# Roseland NJ 07068 INSURER A:Technoiogy insurance Company,Inc 42376 INSURED F orca Preferred Group LLC INSURER B : INSURER C: 3806 SW 148th Ave INSURER D : INSURER E : Miami FL 33185 INSURER F : COVERAGES CERTIFICATE NUMBER:4080110 REVISION NUMBER: MSR LTR TYPE OF INSURANCE ADOL IN8D 8UBR •YVO POLICY NUMBER POLICY EFFIMM'DD/YYYY)POLICY EXP(MM'DDiYYYYj UMTS COMMERCIAL GENERAL LIABILITY CLAIMS-MADE OCCUR EACH OCCURRENCE $ DAMAGE TO RENTEDPREMISES(Ea occurrence)5 MED EXP 1Any one person i 3 PERSONAL &ADV INJURY 3 GENL AGGREGATE LIMIT APPLIES PER policy Sect 1 loc OTHER: GENERAL AGGREGATE 5 PRODUCTS -COMP'OP AGG S 3 AUTOMOBILE LIABILITY ANY AJTO OWNED |SCHEDULED AJ’DS CNLY ALTOSHIRED’NGN-OWNED AJ’OS CNLY ALTOS ONLY COMEMNED SINGLE LIMIT s(Ea accidenti • BODILY INJURY (Per person;5 BODILY in.jry i=er accdert;3 PROPERTY DAMAGE <•Per acddeit i * 5 UMBRELLA LIAB OCCUR EXCESS LIAB CLAIMS-MADE EACH OCCURRENCE 5 AGGREGATE 3 DED RETENTIONS 3 A WORKERS COMPENSATION AND EMPLOYERS'LIABILITY y /NANYPROPRSTORiFARTNERjHXECU^rZE OFFICERiMEMSER EXCLUDED?N (Mandatory in NH| ffvee.despite underDESCRIPTIONO=OPERATIONS OelOW N/A N TWC4417960 05/11/2024 05/11/2025 V PER OTH-/\STATUTE ER EL EACH ACCIDENT $1.000.000 EL DISEASE -EA EMPLOYEE $1.000.000 EL.DISEASE -POLICY UKT $1.000.000 City of South Miami SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF.NOTICE WILL BE DELIVERED IN ACCORDANCE WITH THE POLICY PROVISIONS. 6130 Sunset Drive AUTHORIZED REPRESENTATIVE South Miami FL 33143 ft 'h 61 371 CERTIFICATE OF LIABILITY INSURANCE this certificate does not confer to the certificate holder in lieu of such DATE (MM'DDtY YYY) 01/22/2025 ACORD* THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER.THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND,EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW.THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S),AUTHORIZED REPRESENTATIVE OR PRODUCER,AND THE CERTIFICATE HOLDER. IMPORTANT:If the certificate holder is an ADDITIONAL INSURED,the policy(ies)must have ADDITIONAL INSURED provisions or be endorsed. If SUBROGATION IS WAIVED,subject to the terms and conditions of the policy,certain policies may require an endorsement A statement on PRODUCER Progress^e Insurance PC Box 94739.Cleveland.OH 44101 CONTACTNAME:Progressive Commercial Lines Customer and Aqent Serviarxj PHONE FAX (AIC,No,Ert):1-800-444-4487 (A/C.Nob L VAILAnrwm-proqressrvecorrrnerualHierr^l.pro^ INSURER(S)AFFORDING COVERAGE NAIC 4 insurer A :Progressive Express Insurance Company 10193 INSURED Florida Preferred Group 3806 Sw 148Th AveMiami,FL 33185 INSURER B : INSURER C : INSURER D : INSURER E : INSURER F : COVERAGES CERTIFICATE NUMBER:588149589391997505O012225T15252O REVISION NUMBER: THIS IS TO CERTIFY THAT THE POLICES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIOD INDICATED.NOTWITHSTANDING ANY REQUIREMENT,TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN.THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS, EXCLUSIONS AND CONDITIONS OF SUCH POUCIES.LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. DESCRIPTION OF OPERATIONS /LOCATIONS /VEHICLES (ACORD 101.Addfoonal Romanes Schedule,may be attached If more space Is required) INSR LTR TYPE OF INSURANCE ADOL MO POLICY NUMBER POLICY EFF (MM'DOiYYYY) POLICY EXP (MM/DOlYYYY)UNITS COMMERCIAL GENERAL LIABILITY EACH OCCURRENCE i Cl.AIMS MADE OCCUR DAMAGE 1OREN IEl MED EXP (Any one p< Jenca]$ inson)& PERSONAL &ADV INJURY $ LAMTrpro Y |JECT R: KPPUES PER1LOC GENERAL AGGREGATE * POLIC OTM& PRODUCTS COMP/OP AGG s s A AUTOMO ANY A SILL LIABILITY UTO N N 963266965 11/092024 11/092028 COMBINED SINGLE LIMIT(Ea accident;$ BODILY INJURY (Per person)$100,000fot«.Y X BODILY INJURY (Per aocadent)$300,000 5OM.Y $50,000 $ UMBRLLLA LIAB EXCESS LIAB OCCUR CLAIMS MADE EACH OCCURRENCE s AGGREGATE $ OED RETENTIONS $ AMn imp S COMPENSATION LOYERS-LIABILITY **•R^TOR/PARTNER/EXECUTrVE MEMBERExCLUDED? y In NH) cnOe under riON OF OPERATIONS below N/A I^TUTE ft” ANYPROF OFFICER dIscrip EL.EACH ACCIDENT s EX.DISEASE EA EMPLOYER $ EL.DISEASE POLICY LIMIT $ A See ACORD 101 for additional coverage details N N 963260965 11X192024 11/092026 S CERTIFICATE HOLDER CANCELLATION ©1988-2015 ACORD CORPORATION.All rights reserved. City of South Miami Qty Hall 6130 Sunse4 Drive Miami,FL 33143 SHOULD ANY OF THE ABOVE DESCRIBED POUCIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF,NOTICE WILL BE DEUVERED IN ACCORDANCE WITH THE POUCY PROVISIONS. AUTHORIZED REPRESENTATIVE ACORD 25 (2016/03)The ACORD name and logo are registered marks of ACORD 62 372 AGENCY CUSTOMER ID: acord LOCH: ADDITIONAL REMARKS SCHEDULE Page 1 of 1 AGENCY Progressive Insurance NAMED KSURED Honda Preferred Group 3806 Sw 148Th Ave Miami.FL 33185POLICYNUMBER 963268965 CARRIER Progressive Express Insurance Company NAIC CODE 10193 EFFECTIVE DATE:11/09T2O24 ADDITIONAL REMARKS THIS ADDITIONAL REMARKS FORM IS A SCHEDULE TO ACORD FORM. FORM NUMBER:?5 FORM TITLE:Certificate of Liabiltty Insurance Additional Coverages Insurance coverages)Limits Personal Injury Protection $10,000 w/$0 Ded -Named Insured Only Uninsured Motonsl -Nonstacked Sldb.6b6/$3bb,6o6 Liability coverage may not apply to all scheduled vehicles. ACORD 101 (2008/01)©2008 ACORD CORPORATION.All rights reserved. The ACORD name and logo are registered marks of ACORD P r e p a r e d b y M a r s d e n S e r v i c e s S h a z a r d A l i O ffi c e : 305-340-7524 C e l l : 305-340-7524 E m a i l : S A l i @ m a r s d e n . c o m m a r s d e n . c o m City of South Miami P r o p o s a l f o r J a n i t o r i a l S e r v i c e s R F P N o . F N 2 0 2 4 -17 1 373659 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .7 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .9 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .18 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .22 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .24 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .28 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .30 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .31 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .32 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .33 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .34 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .36 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37 Table of Contents Cover Page Letter of Interest and Executive Summary Proposal Form 1 Proposal Form 2A Proposal Forms 3 and 4 Proposal Forms 5 and 6 Form 7 Form 8- References Form 9 Bio Ayza Mendoza Bio Richard Wilson Bio -Shazard Ali Org Chart for South Miami About Us Charitable Donations Communication 374660 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .38 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .40 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .42 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .43 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .45 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .50 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .55 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .56 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .57 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64 Hiring Practices Training Uniforms Safety Quality Control Transition Emergency Services Integrated Services Certificate of Insurance 2025 Addendum No. 1 Attachment to Addendum No. 1 375661 © 2021 Marsden Services www.marsden.com Shazard Ali Director of Business Development 305-340-7524 SAli@marsden.com January 22, 2025 City of South Miami Attn: Steven P. Kulick 6130 Sunset Drive City of South Miami, Florida 33143 RE: Proposal Package-Letter of Interest Dear Steven, Thank you for the opportunity to submit a bid package in response to the RFP for Janitorial Services for City of South Miami. Marsden Services understands how important it is for City of South Miami (South Miami)to have a janitorial partner who can provide efficient and consistent facility services. I am confident that Marsden can provide you with the skilled teams, comprehensive quality programs, and customer-focused services that are necessary to maintain the cleanliness, appearance, and safety of your property. Our day cleaning program aligns well with the service hours of your locations, and we can certainly provide after hours services to City Hall. Enclosed you will find our proposal. If you would like additional information or have questions, please reach out to me. We look forward to your evaluation of our proposal and the opportunity to discuss a partnership between Marsden Services and South Miami. Sincerely, Shazard Ali Director of Business Development 4 376662 M MARSDEN © 2021 Marsden Services www.marsden.com Executive Summary City of South Miami (South Miami)'s facility is an important component in your everyday business operations. Marsden understands that a building's cleanliness, appearance, and safety has a direct impact on your business and your associates. South Miami needs an experienced service partner who can care for your building and help you to maintain a positive, productive atmosphere. Marsden has been serving clients for over 70 years, providing small and large business including government facilities with well-maintained and welcoming facilities. We get to know each of our clients individually and provide services that are tailored to their needs and their facility's unique environment. Our cleaning teams are carefully vetted and thoroughly trained, and our cleaners receive local support and appropriate site supervision. Our frequent cleaning inspections assure quality expectations are met and our efficient operating spend is kept within strict cost controls. Key Program Components Below are a few program highlights, which are described in detail later in this document. We look forward to meeting with you to discuss our entire program in more depth. Component Benefit Description Full, Qualified Work Resources Peace of Mind from Fully Vetted Staff •Carefully selected staff members o Rigorous new-hire screening measures o HR staff review experience, background, and records •Staff follow security protocols of City of South Miami •Consistent, stable teams with low turnover Site-based, Cleaning Approach High Confidence in Service Performance •City of South Miami-driven service schedules •Work performed during off-hours •Periodic tasks (non-daily): o Scheduled, performed and tracked o Results and schedules sent to City of South Miami •Flexible and trained staff respond to changing needs Rigorous Quality Control Full Contract Compliance •Experience cleaning to ISSA Custodial Standards •Unique Key Performance Indicators (KPIs) for client site •Cleaning inspections and audits via cloud-based, mobile QC system •Detailed performance reporting and quality metrics •Supervisors review daily and periodic work •Labor management ensures full staffing 5 377663 © 2021 Marsden Services www.marsden.com Thank you for your interest in a partnership with Marsden Services. Our goal is to provide exceptional services, but more importantly, to develop a successful relationship with the City of South Miami. Component Benefit Description Advanced Technology and Innovation 100% Performance Transparency and Optimal Efficiency •Cloud-based QC system via mobile devices o Web platform tracks and reports metrics o City of South Miami receives immediate electronic responses •Cleaning industry-specific ERP system o Technology-assisted labor management o Fully integrated financial, operations and workforce management o Streamlines processes and delivers complete picture •Continuous R&D: innovative products, tools, processes Strict Cost Controls Maintaining Budget Goals •Complete transparency with the resources used, activities performed and associated costs •Drive toward budget goals while maintaining service levels •Constantly considering ways to implement value engineering o We work with City of South Miami to find ways to increase efficiencies, improve functionality, or reduce costs o Flexible service offerings to meet client needs •Mindful of cost containment 6 378664MMARSDEN FORM 1 PROPOSAL FORM PACKAGE ACKNOWLEDGEMENTS I hereby propose to furnish the goods and services specified in the Request for Proposals,RFP No. FN2024-17.I agree that my Proposal will remain firm for a period of 180 days after opened by the City in order to allow the City adequate time to evaluate the Proposal. I certify that all information contained in this Proposal is truthful to the best of my knowledge and belief. I further certify that I am duly authorized to submit this Proposal on behalf of the Firm named as the Proposing Firm and that said Firm is ready, willing, and able to perform if awarded the Agreement. I further certify, under oath, that this Proposal is made without prior understanding, agreement, connection, discussion, or collusion with any other person, firm or corporation submitting a Proposal; no officer, employee or agent of the City of South Miami or any other Proposer has an interest in said Proposal. Furthermore, I certify that the undersigned executed this Proposal Form with full knowledge and understanding of matters therein contained and was duly authorized. I further certify that the Proposer acknowledges receipt of all Addenda issued by the City in connection with the RFP (Check the box next to each addendum received). ______ Addendum 1 Addendum 6 ______ Addendum 2 Addendum 7 ______ Addendum 3 Addendum 8 ______ Addendum 4 Addendum 9 _______ Addendum 5 Addendum 10 Attached hereto are the following forms/documents which form a part of this Proposal: Form 1. Proposal Form Package Acknowledgement. Form 2A. Proposer (if Company or Corporation) Form 2B. Proposer Partnership) Form 3. Single Execution Affidavits Form 4. Dispute Disclosure Form 5. Certification Regarding Debarment, Suspension, & Other Responsibility Matters Primary Covered Transactions Form 6. Proposer Survey Form 7. Price Proposal Form Form 8. Reference List Form 9. Key Staff & Proposed Subcontractors 27 of 92 X 7 379665 ’s Certification ’s Certification (if ’s Qualifications FORM 1 PROPOSAL FORM PACKAGE ACKNOWLEDGEMENTS (CONTINUED) ___________________________________________ NAME OF PROPOSER FIRM ____________________________________________ SIGNATURE OF PROPOSER ____________________________________________ NAME & TITLE, TYPED OR PRINTED MAILING ADDRESS ____________________________________________ ____________________________________________ (____) ______________________________________ TELEPHONE NUMBER State of Florida County of The foregoing instrument was acknowledged before me by means of physical presence or online notarization, this day of , 20 , by (name of person) as (type of authority) for (name of party on behalf of whom instrument is executed). Notary Public (Print, Stamp, or Type as Commissioned) Personally known to me; or Produced identification (Type of Identification: ) Did take an oath; or Did not take an oath 28 of 92 8 380666 Marsden South,LLC Shazard Ali,Director of Business Development x DocuSigned by: SlwywtL (Ka 405C1E0229AE44A... 1388 SW 8th Street Pompano Beach,FL 33069 305-340-7524 Ohio Franklin 20th Marsden South,LLC January 25 Director of Business Development X Shazard Ali 13A217011A6B46A... JACQUfUHE S MOORE Notary Public State of Ohio My Comm.Expire! January 3,2028 9 381667 FORM 2A PROPOSER’S CERTIFICATION (if Company or Corporation) CERTIFICATE STATE OF MINNESOTA ) )SS COUNTY OF HENNEPIN ) I HEREBY CERTIFY that the Board of Directors of Marsden South,LLC state of Delaware make the resolution date January 17,2025: RESOLVED,that,as President of the Corporation/Company,Mark Dorenkott be and is hereby authorized to execute the Proposal dated,January 20,2024 to the City of South Miami for RFP No.FN2024-17 “Janitorial Services,”and that this execution thereof,attested by the Secretary of the Corporation/Company,and shall be the official act and deed of this Corporation/Company. I further certify that said resolution is now in full force and effect. IN WITNESS WHEREOF,I have hereunto set my hand and affixed the official seal of corporation/company on this the 20th of January,2025. (SEAL) Damon I -asor (Jan 20,2025 11:52 C SI) Damon Fraser Chief Administrative Officer &Secretary Marsden Services,LLC 29 of 92 10 382668 FORM 3 SINGLE EXECUTION AFFIDAVITS This form must be signed and sworn to in the presence of a notary public OR OTHER OFFICIAL AUTHORIZED TO ADMINISTER OATHS. THIS FORM COMBINES SEVERAL AFFIDAVIT STATEMENTS TO BE SWORN TO BY THE PROPOSER OR PROPOSER AND NOTARIZED BELOW.IN THE EVENT THE PROPOSER OR PROPOSER CANNOT SWEAR TO ANY OF THESE AFFIDAVIT STATEMENTS,THE PROPOSER OR PROPOSER IS DEEMED TO BE NON¬ RESPONSIBLE AND IS NOT ELIGIBLE TO SUBMIT A PROPOSAL/PROPOSAL. THESE SINGLE EXECUTION AFFIDAVITS ARE SUBMITTED TO THE CITY OF SOUTH MIAMI AND ARE STATEMENTS MADE: By:Daniel Niswonger For (Name of Proposing or Bidding Entity):Marsden South,LLC Whose business address is:12501 Reed Road,Sugar Land,TX 77478 And (if applicable)its Federal Employer Identification Number (FEIN)is:46-4325823 (if the entity does not have an FEIN,include the Social Security Number of the individual signing this sworn statement.SS#:) Americans with Disabilities Act Compliance Affidavit The above named firm,corporation or organization is in compliance with and agrees to continue to comply with,and assure that any subcontractor,or third party contractor under this project complies with all applicable requirements of the laws listed below including,but not limited to, those provisions pertaining to employment,provision of programs and services,transportation, communications,access to facilities,renovations,and new construction. •The American with Disabilities Act of 1990 (ADA),Pub.L.101-336,104 Stat 327,42 USC 1210112213 and 47 USC Sections 225 and 661 including Title I,Employment;Title II,Public Services;Title III,Public Accommodations and Services Operated by Private entities;Title IV,Telecommunications;and Title V,Miscellaneous Provisions. •The Florida Americans with Disabilities Accessibility Implementation Act of 1993, Section 553.501-553.513,Florida Statutes: •The Rehabilitation Act of 1973,229 USC Section 794; •The Federal Transit Act,as amended 49 USC Section 1612; •The Fair Housing Act as amended 42 USC Section 3601-3631. Proposer Initials 31 of92 11 383669 Public Entity Crimes Affidavit I understand that a “public entity crime”as defined in Paragraph 287.133(1)(g),Florida Statutes, means a violation of any state or federal law by a person with respect to and directly related to the transaction of business with any public entity or with an agency or political subdivision of any other state or of the United States,including but not limited to,any Proposal or contract for goods or services to be provided to any public entity or an agency or political subdivision of any other state or of the United States and involving antitrust,fraud,theft,bribery,collusion,racketeering, conspiracy,or material misrepresentations. I understand that “convicted”or “conviction”as defined in Paragraph 287.1 33(l)(b),Florida Statutes,means a finding of guilt or a conviction of a public entity crime,with or without an adjudication of guilt,in any federal or state trial court of record relating to charges brought by indictment or information after July 1,1989,as a result of a jury verdict,non-jury trial,or entry of a plea of guilty or nolo contendere. I understand that an “affiliate”as defined in Paragraph 287.1 33(l)(a),Florida Statutes,means: 1.A predecessor or successor of a person convicted of a public entity crime;or 2.An entity under the control of any natural person who is active in the management of the entity and who has been convicted of a public entity crime.The term “affiliate”includes those officers, directors,executives,partners,shareholders,employees,members,and agents who are active in the management of an affiliate.The ownership by one person of shares constituting a controlling interest in another person,or a pooling of equipment or income among persons when not for fair market value under an arm’s length agreement,shall be a prima facie case that one person controls another person.A person who knowingly enters into a joint venture with a person who has been convicted of a public entity crime in Florida during the preceding 36 months shall be considered an affiliate. I understand that a “person”as defined in Paragraph 287.133(l)(e),Florida Statutes,means any natural person or entity organized under the laws of any state or of the United States with the legal power to enter into a binding contract and which proposals or applies to Proposal on contracts for the provision of goods or services let by a public entity,or which otherwise transacts or applies to transact business with a public entity.The term “person”includes those officers,directors, executives,and partners,shareholders,employees,members,and agents who are active in management of an entity. Based on information and belief,the statement,which I have marked below,is true in relations to the entity submitting this sworn statement. (INDICATE WHICH STATEMENT APPLIES.) IX Neither the entity submitting this sworn statement,nor any of its officers,directors, executives,partners,shareholders,employees,members,or agents who are active in the management of the entity,nor any affiliate of the entity has been charged with ad convicted of a public entity crime subsequent to July 1,1989. The entity submitting this sworn statement,or one or more of its officers,directors, executives,partners,shareholders,employees,members,or agents who are active in the 32 of 92 12 384670 management of the entity,or an affiliate of the entity has been charged with and convicted of a public entity crime subsequent to July 1,1989. The entity submitting this sworn statement,or one or more of its officers,directors, executives,partners,shareholders,employees,members,or agents who are active in the management of the entity,or an affiliate of the entity has been charged with and convicted of a public entity crime subsequent to July 1,1989.However,there has been a subsequent proceeding before a Hearing Officer of the State of Florida ,Division of Administrative Hearings and the final Order entered by the Hearing Officer determined that it was not in the public interest to place the entity submitting this sworn statement on the convicted vendor list (attach a copy of the final order). I understand that the submission of this form to the contracting officer for the public entity identified in paragraph 1 above is for that public entity only and that this form is valid through December 31 of the calendar year in which it is filed.I also understand that I am required to inform the public entity prior to entering into a contract in excess of the threshold amount provided in Section 287.017,Florida Statutes for category two of any change in the information contained in this forVi. Proposer Initials No Conflict of Interest or Contingent Fee Affidavit Proposer warrants that neither it nor any principal,employee,agent,representative nor family member has paid or will pay any fee or consideration that is contingent on the award or execution of a contract arising out of this solicitation.Proposer also warrants that neither it nor any principal, employee,agent,representative nor family member has procured or attempted to procure this contract in violation of any of the provisions of the Miami-Dade County and City of South Miami conflict of interest or code of ethics ordinances.Further,Proposer acknowledges that any violation of these warrants will result in the termination of the contract and forfeiture of funds paid or to be paid to the Proposer should the Proposer be selected for the performance of this contract. Proposer Initials Business Entity Affidavit Proposer hereby recognizes and certifies that no elected official,board member,or employee of the City of South Miami (the "City”)shall have a financial interest directly or indirectly in this transaction or any compensation to be paid under or through this transaction,and further,that no City employee,nor any elected or appointed officer (including City board members)of the City, nor any spouse,parent or child of such employee or elected or appointed officer of the City,may be a partner,officer,director or proprietor of Proposer or Vendor,and further,that no such City employee or elected or appointed officer,or the spouse,parent or child of any of them,alone or in combination,may have a material interest in the Vendor or Proposer.Material interest means direct or indirect ownership of more than 5%of the total assets or capital stock of the Proposer.Any exception to these above described restrictions must be expressly provided by applicable law or ordinance and be confirmed in writing by City.Further,Proposer recognizes that with respect to this transaction or Proposal,if any Proposer violates or is a party to a violation of the ethics 33 of 92 13 385671 Proposer Initials Anti-Collusion Affidavit Proposer Initials Scrutinized Company Certification 1.Proposer certifies that it and its subcontractors are not on the Scrutinized Companies that Boycott Israel List.Pursuant to Section 287.135,F.S.,the City may immediately terminate the Agreement that may result from this RFP at its sole option if the Proposer or its subcontractors are found to have submitted a false certification;or if the Proposer,or its subcontractors are placed on the Scrutinized Companies that Boycott Israel List or is engaged in the boycott of Israel during the term of the Agreement. 2.If the Agreement that may result from this RFP is for more than one million dollars,the Proposer certifies that it and its subcontractors are also not on the Scrutinized Companies with Activities in Sudan,Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List,or engaged with business operations in Cuba or Syria as identified in Section 287.135,F.S.pursuant to Section 287.135,F.S.,the City may immediately terminate the Agreement that may result from this RFP at its sole option if the Proposer,its affiliates,or its subcontractors are found to have submitted a false certification;or if the Proposer,its affiliates, or its subcontractors are placed on the Scrutinized Companies with Activities in Sudan List,or 1.Proposer/Proposer has personal knowledge of the matters set forth in its Proposal/Proposal and is fully informed respecting the preparation and contents of the attached Proposal/Proposal and all pertinent circumstances respecting the Proposal/Proposal; 2.The Proposal/Proposal is genuine and is not a collusive or sham Proposal/Proposal;and 3.Neither the Proposer/Proposer nor any of its officers,partners,owners,agents,representatives, employees,or parties in interest,including Affiant,has in any way colluded,conspired, connived,or agreed,directly or indirectly with any other Proposer/Proposer,firm,or person to submit a collusive or sham Proposal/Proposal,or has in any manner,directly or indirectly, sought by agreement or collusion or communication or conference with any other Proposer/Proposer,firm,or person to fix the price or prices in the attached Proposal/Proposal or of any other Proposer/Proposer,or to fix any overhead,profit,or cost element of the Proposal/Proposal price or the Proposal/Proposal price of any other Proposer/Proposer,or to secure through any collusion,conspiracy,connivance or unlawful agreement any advantage against the City or any person interested in the proposed Contract. ordinances or rules of the City,the provisions of Miami-Dade County Code Section 2-11.1,as applicable to City,or the provisions of Chapter 112,part III,Fla.Stat.,the Code of Ethics for Public Officers and Employees,such Proposer may be disqualified from furnishing the goods or services for which the Proposal or Proposal is submitted and may be further disqualified from submitting any future proposals or Proposal for goods or services to City. 34 of 92 14 386672 Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List,or engaged with business operations in Cuba or Syria during the term of the Agreement. 3.The Proposer agrees to observe the above requirements for applicable subcontracts entered into for the performance of work under the Agreement that may result from this RFP.As provided in Subsection 287.135(8),F.S.,if federal law ceases to authorize the above-stated contracting prohibitions then they shall become inoperative. Proposer Initials Drug-Free Workplace Affidavit Proposer hereby recognizes that,pursuant to F.S.§287.087,preference shall be given to businesses with drug-free workplace programs when two proposals/Proposal are equal with respect to price,quality,and service.Proposer understands that in order to qualify as a drug-free workplace,Proposer must: a)Publish a statement notifying employees that the unlawful manufacture,distribution, dispensing,possession,or use of a controlled substance is prohibited in the workplace and specifying the actions that will be taken against employees for violations of such prohibition. b)Inform employees about the dangers of drug abuse in the workplace,the Proposer’s policy of maintaining a drug-free workplace,any available drug counseling,rehabilitation,and employee assistance programs,and the penalties that may be imposed upon employees for drug abuse violations. 1)Give each employee engaged in providing commodities or contractual services under the RFP a copy of the statement specified in subsection (1). 2)Notify employees that,as a condition of working on the commodities or contractual services under the RFP,the employee must abide by the terms of the statement and will notify the employer of any conviction of,or plea of guilty or nolo contendere to,any violation of chapter 893 or of any controlled substance law of the United States or any state,for a violation occurring in the workplace no later than five (5)days after such conviction. 3)Impose a sanction on,or require the satisfactory participation in a drug abuse assistance or rehabilitation program if such is available in the employee’s community,by any employee who is so convicted. 4)Make a good faith effort to continue to maintain a drug-free workplace through the implementation of this section. Based on information and belief,the statement,which I have marked below,is true in relations to the entity submitting this sworn statement. (INDICATE WHICH STATEMENT APPLIES.) IX The entity submitting this sworn statement is a drug-free workplace and is in full 35 of 92 15 387673 compliance with the requirements set forth under F.S.§287.087. The entity submitting this sworn statement is not a drug-free workplace. Proposer Initials City Non-Discrimination Requirements Affidavit Proposer understands that pursuant to Section 3-1.1 of the Code of the City of South Miami,the City will not enter into or award a contract to an entity engaged in a boycott. Proposer understands that “Boycott”as defined under Section 3-1.1 of the Code of the City of South Miami means to blacklist,divest from,or otherwise refuse to deal with a nation or country, or to blacklist or otherwise refuse to deal with a person or entity when the action is based on race, color,national origin,religion,sex,gender identity,sexual orientation,marital or familial status, age,or disability in a discriminatory manner.The term boycott does not include a decision based upon business or economic reasons,or boycotts,embargoes,trade restrictions,or divestments that are specifically authorized or required by federal law or state law. Proposer certifies that it is not engaged in a boycott,and is in full compliance with Section 3-1.1 'ode of the City of South Miami. Proposer Initials Acknowledgment,Warranty,and Acceptance 1.Contractor warrants that it is willing and able to comply with all applicable state of Florida laws,rules and regulations. 2.Contractor warrants that it has read,understands,and is willing to comply with all requirements of RFP No.FN2024-03 and any addendum/addenda related thereto. 3.Contractor warrants that it will not delegate or subcontract its responsibilities under an agreement without the prior written permission of the City Commission or City Manager,as applicable. 4.Contractor warrants that all information provided by it in connection with this Proposal is true andaccurate. Proposer Initials [REMAINDER OF PAGE LEFT INTENTIONALLY BLANK. SIGNATURE PAGE FOLLOWS.] 36 of 92 16 388674 In the presence of: Witness #1 Print l^ame:Shanb'Losey' Witness #2 Print Name:Carrie Hughes Print Name:Daniel Niswonger Title:President (Manager) State of Flertda Ohio County of Franklin ACKNOWLEDGMENT The foregoing instrument was acknowledged before me by means of X physical presence or _ online notarization,this 20th day of January ,2025 ,by Daniel Niswonger (name of person)as President (Manager)(type of authority)for Marsden South,LLC (name of party on behalf of whom instrument is executed). X Personally known to me;or Produced identification (Type of Identification: ) Did take an oath;or Did not take an oath JACQUELINE S MOORE Notary Public State of Ohio My Comm.Expires January 3,2028 37 of 92 17 389675 FORM 4 DISPUTE DISCLOSURE Answer the following questions by placing an “X”after “Yes”or “No”.If you answer “Yes”, please explain in the space provided,or on a separate sheet attached to this form. 1.Has your firm or any of its officers,received a reprimand of any nature or been suspended by the Department of Professional Regulations or any other regulatory agency or professional associations within the last five (5)years? YES NO X 2.Has your firm,or any member of your firm,been declared in default,terminated or removed from a contract or job related to the services your firm provides in the regular course of business within the last five (5)years? YES NO X 3.Has your firm had against it or filed any requests for equitable adjustment,contract claims, Proposal protests,or litigation in the past five (5)years that is related to the services your firm provides in the regular course of business? YES NO X If yes,state the nature of the request for equitable adjustment,contract claim,litigation,or protest, and state a brief description of the case,the outcome or status of the suit and the monetary amounts of extended contract time involved. I hereby certify that all statements made are true and agree and understand that any misstatement or misrepresentation of falsification of facts shall be cause for forfeiture of rights for further consideration of this Proposal or Proposal for the City of South Miami. ACKNOWLEDGMENT State of FfcridaOhio County of Franklin The foregoing instrument was acknowledged before me by means of KI physical presence or online notarization, this 20th day of January ,20 25 .by Daniel Niswonger (name of person) as President (Manager)(type of authority)for Marsden South,LLC (name of party on behalf of whom instrument is executed).J/1 _ X Personally known to me;or Produced identification (Type of Identification:. Did take an oath;or Did not take an oath JACQUELINE S MOORE Notary Public State of Ohio My Comm.Expires January 3,2028 38 of 92 FORM 5 CERTIFICATION REGARDING DEBARMENT, SUSPENSION, AND OTHER RESPONSIBILITY MATTERS PRIMARY COVERED TRANSACTIONS This certification is required by the regulations implementing Executive Order 12549, Debarment and Suspension, 13 CFR Part 145. The regulations were published as Part VII of the May 26, 1988 Federal Register (pages 19160-19211). Copies of the regulations are available from local offices of the U.S. Small Business Administration. (1)The prospective primary participant certifies to the best of its knowledge and belief that it and its principals: (a) Are not presently debarred, suspended, proposed for disbarment, declared ineligible, or voluntarily excluded from covered transactions by any Federal department or agency; (b) Have not within a three-year period preceding this application been convicted of or had a civil judgment rendered against them for commission of fraud or a criminal offense in connection with obtaining, attempting to obtain, or performing a public (Federal, State, or local) transaction or contract under a public transaction; violation of Federal or State antitrust statutes or commission of embezzlement, theft, forgery, bribery, falsification or destruction of records, making false statements, or receiving stolen property; (c) Are not presently indicted for or otherwise criminally or civilly charged by a governmental entity (Federal, State, or local) with commission of any of the offenses enumerated in paragraph (1)(b) of this certification; and (d) Have not within a three-year period preceding this application had one or more public transactions (Federal, State, or local) terminated for cause or default. (2)Where the prospective primary participant is unable to certify to any of the statements in this certification, such prospective primary participant shall attach an explanation to this Statement of Qualifications. Business Name_________________________________________________________ Date_________________________ By: Signature of Authorized Representative Name and Title of Authorized Representative 39 of 92 Marsden South, LLC Mark Dorenkott, President 1/20/2025 18 390676 x DocuSigned by: Awl 21CA8B66C90344D... FORM 6 PROPOSER’S QUALIFICATIONS SURVEY COMPANY QUALIFICATIONS QUESTIONNAIRE Please complete this Company Qualifications Questionnaire. By completing this form and submitting a response to the RFP, you certify that any and all information contained in the Proposal is true, that your response to the RFP is made without prior understanding, agreement, or connections with any corporation, firm or person submitting a response to the RFP for the same materials, supplies, equipment, or services, is in all respects fair and without collusion or fraud, that you agree to abide by all terms and conditions of the RFP, and certify that you are authorized to sign for the Proposer’s firm. Some responses may require the inclusion of separate attachments. Separate attachments should be as concise as possible, while including the requested information. In no event should the total page count of all attachments to this Form exceed five (5) pages. Some information may not be applicable; in such instances, please insert “N/A”. Firm Name Principal Business Address Telephone Number Facsimile Number Email Address Federal I.D. No. or Social Security Number Municipal Business Tax/Occupational License No. FIRM HISTORY AND INFORMATION How many years has the firm has been in business under its current name and ownership? Please identify the Firm’s document number with the Florida Division of Corporations and date the Firm registered/filed to conduct business in the State of Florida: Document Number Date Filed Please identify the Firm’s category with the Florida Department of Business Professional Regulation (DBPR), DBPR license number, and date licensed by DBPR: Category License No. Date Licensed 40 of 92 Marsden South, LLC 12501 Reed Road, Sugar Land, TX 77478 305-340-7524 888-788-0084 sali@marsden.com 46-4325823 11 M14000000069 12/30/2013 19 391677 Please indicate the type of entity form of the Firm (if other, please describe): □ Individual □ Partnership □ Corporation □ LLC □ LLP □ Other Please identify the Firm’s primary business: Please identify the number of continuous years your Firm has performed its primary business: Please list all professional licenses and certifications held by the Firm, its Qualifier/Principal, and any Key Staff, including any active certifications of small, minority, or disadvantaged business enterprise, and the name of the entity that issued the license or certification: License/Certification Type Name of Entity Issuing License or Certification License No. License Issuance Date Please identify the name, license number, and issuance date of any prior companies that pertain to your Firm: License/Certification Type Name of Entity Issuing License or Certification License No. License Issuance Date Please identify all individuals authorized to sign for the entity, their title, and the threshold/level of their signing authority: Authorized Signor’s Name Title Signing Authority Threshold (All, Cost up to $X-Amount, No Cost, Other) Please identify the total number of Firm employees, managerial/administrative employees, and identify the total number of trades employees by trade (e.g., 20 electricians, 5 laborers, 2 mechanics, etc.): Total No. of Employees Total No. of Managerial/Administrative Employees Total No. of Trades Employees by Trade INSURANCE INFORMATION Please provide the following information about the Firm’s insurance company: Insurance Carrier Name Insurance Carrier Contact Person 41 of 92 X commercial janitorial 65 N/A N/A Mark Dorenkott President All Daniel Niswonger President Marsden Services -- All 866 43 0 823Service Workers Marsh & McLennan Agency, Inc. Veronica Lawrence, AINS, ARM 20 392678 Insurance Carrier Address Telephone No. Email Has the Firm filed any insurance claims in the last five (5) years? □ No □ Yes If yes, please identify the type of claim and the amount paid out under the claim: FIRM OWNERSHIP Please identify all Firm owners or partners, their title, and percent of ownership: Owner/Partner Name Title Ownership (%) Please identify whether any of the owners/partners identified above are owners/partners in another entity: □ No □ Yes If yes, please identify the name of the owner/partner, the other entity’s name, and percent of ownership held by the stated owner/partner: Owner/Partner Name Other Entity Name Ownership (%) RECENT CONTRACTS Please identify the five (5) most recent contracts in which your Firm has provided services to other public entities: Public Entity Name Contact Person Telephone No. Email Address Date Awarded By signing below, Proposer certifies that the information contained herein is complete and accurate to the best of Proposer’s knowledge. Firm: Authorized Signature: Date: Print or Type Name: Title: 42 of 92 6160 Golden Hills Dr, Minneapolis, MN 55416 763-746-8000 Marsdencertificates@marshmma.com Manager Managed corporation Marsden Holding, LLC 100% X Marsden South, LLC 100% Scioto Services, LLC 100% Marden Services, LLC 100% 1 Stone Solutions, LLC 100% Marsden Central, LLC 100% Marsden Mechanical, LLC 100% Marsden South, LLC Mark Dorenkott President X Evon Parker v. Marsden South, L.L.C. et al., Court File No. 2021-57199 (Tex. Dist. Ct. 2022) (slip and fall claim; settled) City of Fort Lauderdale Kevin Kochersperger 954-828-5873 kkochersperger@fortlauderdaile.gov May 1, 2024 City Pembroke Pines Amelia Mohamed 954-961-6067 amohamed@ppines.com April 1, 2024 City of Miami Springs Amy Jaime 305-805-5054 jaimea@miamisprings-fl.gov Aug 1, 2023 Broward College Marcus Wilson 954-201-6974 mwilson2@broward.edu July 1, 2022 The City of Cooper City Dawn Deland 954-434-2300 ddeland@coopercityfl.org March 1, 2019 1/20/2025 21 393679 x DocuSigned by: AW- 21CA8B66C90344D... FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services, Section 3. NOTE: OVER THE TERM OF THE AGREEMENT, THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS, DEPENDING UPON CONDITIONS. IN THOSE CASES, THE ANNUAL FEE WILL BE ADJUSTED A. ANNUAL FEE YEAR ANNUAL FEE Year 1 $ Year 2 $ Year 3 $ Year 4 (Option Year) $ Year 5 (Option Year) $ TOTAL$ B. SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch; City Hall (1st & 2nd Floor); Police Department (1st & 2nd Floor) $ Community Center (Multi-Purpose, Arts & Crafts Computer Lab & Education Room)$ Indoor Basketball Gymnasium/Bleachers $ Marshall Williamson building, commonly known as Mobley building $______________________ 43 of 92 91,964.58 94,723.52 94,723.52 94,723.52 31,599.00 26,608.16 5,401.78 13,454.05 89,285.57 465,420.71 22 394680 USING THE “SCHEDULE OF VALUES”MATRIX BELOW. Senior Citizens Center $ Public Works $ Dante Fascell Park $______________________ Firm: Authorized Signature: Date: Print or Type Name: Title: 44 of 92 4,971.66 3,759.71 3,491.21 Marsden South Shazard Ali January 22, 2025 Director of Business Development 23 395681 FORM 8 REFERENCE LIST IN ADDITION TO THE INFORMATION REQUIRED ON THIS FORM, PROPOSER SHALL PROVIDE A MINIMUM OF FOUR (4) REFERENCE LETTERS. REFERENCE #1 Public Entity Name: Reference Contact Person/Title/Department: Contact Number & Email Public Entity Size/Number of Residents/Square Mileage: Event(s) Completed (include Name of Project/Event, Date of Event Start/Completion, Details on Size/Scope of Work/Complexity) Is the Contract still Active? Yes No 45 of 92 The City of Miami Springs Amy Jaime/Procurement Specialist/Procurement 305-805-5054 jaime@miamisprings-fl.gov 90,000 Square Feet- 6 locations and 8 buildings Janitorial Services for all city buildings. We stared the contract in August of 2023 and is a current ongoing client. X 24 396682 REFERENCE #2 Public Entity Name: Reference Contact Person/Title/Department: Contact Number & Email Public Entity Size/Number of Residents/Square Mileage: Event(s) Completed (include Name of Project/Event, Date of Event Start/Completion, Details on Size/Scope of Work/Complexity) Is the Contract still Active? Yes No 46 of 92 Broward College Marcus Wilson/Vice President of Facilities/Collegewide Maintenance 954-201-6974 mwilson2@broward.edu 2 Campuses with 1,000 plus students and faculty. Janitorial services 3 shifts including day porters and exterior ground X cleaning over 1 million square feet and approximately 80 buildings. We started services in July 2022 and is currently servicing the 2 campuses. 25 397683 REFERENCE #3 Public Entity Name: Reference Contact Person/Title/Department: Contact Number & Email Public Entity Size/Number of Residents/Square Mileage: Event(s) Completed (include Name of Project/Event, Date of Event Start/Completion, Details on Size/Scope of Work/Complexity) Is the Contract still Active? Yes No 47 of 92 The City of Cooper City Dawn Deland/Senior Admin Specialist/Facilities 954-434-2300 ddeland@coopercityfl.org 40,000 Square Feet Janitorial Services for Public works, community center, city X hall and parks and recreation. We serviced the city from March 2019 to March 2023. 26 398684 REFERENCE #4 Public Entity Name: Reference Contact Person/Title/Department: Contact Number & Email Public Entity Size/Number of Residents/Square Mileage: Event(s) Completed (include Name of Project/Event, Date of Event Start/Completion, Details on Size/Scope of Work/Complexity) Is the Contract still Active? Yes No 48 of 92 The City of Fort Lauderdale Kevin Kochersperger/Facilities Manager/Facility Department 954-828-5873 kkochersperger@fortlauderdale.gov 24 City Buildings throught Fort Lauderdale May of 2024 and is currently serving all buildings. X Janitorial Services for all city buildings. We started the contract in 27 399685 FORM 9 KEY STAFF & PROPOSED SUBCONTRACTORS KEY STAFF required, please copy/duplicate this page and attach to this Form. Additional space: Name Title Years of Experience Years with Firm Licenses/Certifications qualifications than the Key Staff they will substitute for where substitute is required due to attrition, turnover, or a specific request by the City: 49 of 92 Ayza Mendoza Operations Manager 12 years 10 years Richard Wilson Senior Operations Manager 30 years 5 years Shazard Ali Director of Business Development 13 years 21 years team of supervisors and specialty technicians that can substitute for Ayza. Bill Ellis can also substitute for Richard Wilson and Mark Dorenkott our President can substitute for Richard for vacations and PTO. We also We have other Operation Managers in South Florida, Shaday Cleare and Bill Ellis along with a have another Business Development Manager that can substitute for Shazard Ali. Marsden has a team of HR specialist that provide support to all departments. 28 400686 Please complete the following chart with the Firm’s proposed Key Staff.If additional space is No Yes Please explain the Firm’s ability and resources to substitute personnel with equal or higher Key Staff Name Area of Responsibility Client Commitment (Hours/week) Period of Engagement PROPOSED SUBCONTRACTORS The undersigned Proposer hereby designates, as follows, all major subcontractors whom they propose to utilize for the major areas of work for the services. The bidder is further notified that all subcontractors shall be properly licensed, bondable, and shall be required to furnish the City with a Certificate of Insurance in accordance with the contract general conditions. Failure to furnish this w.) Subcontractor Name & Address Scope of Work License Number Firm: Authorized Signature: Date: Print or Type Name: Title: 50 of 92 Ayza Mendoza South Florida 8 hours Monday to Friday Richard Wilson South Florida 2 hours Monday to Friday Shazard Ali South Florida 1 hour First 90 days Operations Leadership Client Relations NA we will self perform the work 100% Marsden Soutth Shazard Ali January 22, 2025 Director of Business Development 29 401687 Please identify each Key Staff member’s engagement commitments that will exist concurrently with the City’s Services: information shall be grounds for rejection of the bidder’s proposal.(If no subcontractors are proposed,state “None”on first line belo I came to Marsden with over 20 years of experience in customer service and account management. I have experience in quality, employee and facility management. I have been with Marsden since 2017 and currently oversee the North Miami and West Palm Beach operations. My focus has been on delivering service excellence and measuring employee success. I have a beautiful family formed 35 years ago and with 3 wonderful children of 34, 27 and 20, I love to celebrate each special date of our lives. I enjoy cooking and spending time at home. And my best hobby is decorating and organizing any party to celebrate. 30 402688 Richard Wilson Bio With over 30 years of dedicated experience in the cleaning industry and more than 20 years in management, I have cultivated vast expertise in delivering quality service and fostering team growth. I began my career in Minneapolis, MN, and have spent the last eight years thriving in South Florida, where I continue to lead and innovate within the field. Outside of work, I cherish spending time with my family and exploring the great outdoors. Camping and nature have always been passions of mine, and I’ve recently discovered a love for Cruise Ships, which has opened up new horizons for adventure. A devoted fan of sports, I proudly support the Minnesota Vikings and Wild. I look forward to what the future holds, both professionally and personally! 31 403689 Shazard Ali, Director of Business Development Shazard Ali joined the Marsden South team as the Director of Business Development in 2013. During his tenure, Shazard has had many achievements at Marsden. In 2016 he won the Skip Marsden Outstanding Performance Award for his business development and client relations performance. In 2017 Shazard was named a Marsden Ambassador and a member of the President’s Club for outstanding performance. In the past decade, he has been in the top 5 in the country when it comes to achieving goals and quotas. Shazard comes to the Marsden team from World Emblem where he was a Regional Sales Manager. Prior to World Emblem, Shazard worked in the janitorial and facility services industry with Crestwood Services and Coverall Cleaning Concepts. At Crestwood Shazard was Director of Sales and Business Development with a focus on growth for the company and building a Sales team during 2009 to 2012. At Coverall, Shazard was Regional Director for the Pembroke Pines office during 2003 to 2008. Shazard attended Broward College and resides in Hollywood, Florida with his soon-to-be fiancé. 32 404690 The City of South Miami Safety HR Work Order Center Administrative Partners Shazard Ali – Business Development Executive Richard Catchman President Business Development Organization & Management Structure Mark Dorenkott President Ric Wilson Senior Operations Manager Florida Project Managers Ayza Mendoza/Shaday Cleare Day time Janitors Nighttime Janitor 33 405691 M MARSDENFSOUTH Marsden was established in 1952 and today, we operate as a full-spectrum facility services provider. Every day, our associates support thousands of clients with quality-based, customer-focused solutions. We provide clients across the country with clean, safe, and healthy workplaces. About Marsden Services We are building a culture of excellence, consistency, and a passion for finding new ways to raise the bar in how we are caring for your workplace. Marsden provides clients with a unique combination of national strength and local presence. Despite our size, our focus is on the local markets. Each local Marsden management team is invested in its community and local clients, providing personalized service. Our local teams leverage our resources as a large organization – including technology, equipment, supplies, subject matter experts, and financial support – to better serve their clients. Through our combined national and local operations, we provide our clients with the strength of a large corporation and the individualized care of a small business. © 2021 Marsden Services www.marsden.com ABOUT US We think and operate differently in the way we care for our client’s workplaces. Serving in leadership roles for several industry associations, we learn early about the top issues and challenges effecting building environments and use that knowledge to better support our clients and care for their facilities. Caring for your workplace ® Founded in 1952 in St. Paul, MN by Skip Marsden 5 service lines: Janitorial, Security, Mechanical, Emergency Services, and Facility Management Over 9,000 employees operating out of more than 55 office locations 350M sq ft of commercial space serviced every day 34 406692 MARSDEN o WE ARE RELATIONSHIP BUILDERS Relationships drive everything we do, and we approach each relationship with empathy and integrity. We get to know and value the needs, motivations, goals, and priorities of everyone we work with, whether it’s clients, associates, stakeholders, community partners, or vendors. WE ARE CONSTANT ADVANCERS We strive for growth in every area of our business. We aim to operate profitably so that we can continue developing, expanding, and taking on new challenges. As we grow our business to better serve our clients, we encourage associates to grow in their careers and help them to develop professionally and personally. WE ARE SOLUTION SEEKERS When we see a problem or a need, we find the solution. We’re always searching for new ways to solve problems for our customers, our industry, and our community. This has led to expanding our service lines, implementing new technologies, deploying new products, and forming key partnerships. WE ARE POSITIVE INFLUENCERS We are intentional about having a positive impact through our work. We create cleaner, safer, and healthier workplaces; we make our clients’ jobs easier; we invest in an inclusive workplace and associate wellbeing; and we donate 10% of pre-tax profits to help support our community. RELATIONSHIP BUILDERS SOLUTION SEEKERS POSITIVE INFLUENCERS CONSTANT ADVANCERS Marsden is one of the founding members of the Cleaning Coalition of America (CCA). The CCA was established in 2020 to represent commercial cleaning companies and their employees. The CCA advocates on behalf of commercial janitorial workers, who are members of the essential services workforce and who play a vital role in keeping communities safe and healthy through important cleaning and disinfecting services. Marsden is one of the founding members of the Cleaning Coalition of America. Our Core Values Industry Associations Marsden is actively involved in several industry associations, including the Building Service Contractors Association International (BSCAI); Building Owners and Managers Association International (BOMA); International Facility Management Association (IFMA); and the Cleaning Coalition of America. Marsden also holds a national APPA membership. By serving in leaderships roles for these industry associations, we learn early about the top issues and challenges facing building environments and have first access to new best practices, technologies, and solutions for our clients. © 2021 Marsden Services www.marsden.com ABOUT US 35 407693 Cleaning Coalition of America MARSDEN Our goal through our charitable giving initiatives is to enrich and build strong communities. We do this by creating partnerships with charitable organizations and matching our resources with the needs of the community. We believe in funding programs that support opportunities for people to become well-educated and self-sufficient, leading to healthier communities and greater individual success. Marsden seeks out organizations that are creative, proactive, innovative, and results-oriented. The majority of Marsden grants are awarded in communities in which Marsden and its affiliates do business. We make it our mission to fund projects and programs that build Marsden communities and make them better places to live, work, and raise families. We encourage and support our employees’ efforts to become volunteers, board members, and committee chairs with local nonprofits. Our Commitment to Community Early Childhood Education Programs/projects that provide high-quality experiences for pre-school-aged children that result in enhanced social skills and school readiness. Youth Development Programs/projects that promote healthy social and academic development of youth, with an emphasis on fostering their aspirations to stay in school and pursue higher education or vocational training. Workforce Development Programs/projects that strengthen the workforce in our communities to position and prepare under/unemployed individuals for career advancement and greater self-sufficiency. Community Revitalization Programs/projects aimed at increasing the vitality of economically disadvantaged neighborhoods, such as the development of small businesses, affordable housing, and/or other important community assets such as community centers. Although we donate to several different causes, we have four key areas of focus. © 2021 Marsden Services www.marsden.com CHARITABLE GIVING Since 1952, Marsden Services has been deeply embedded in the communities we serve. Our founder, Skip Marsden, established a legacy of generosity and stewardship that we continue to live out today. 70 Years of Giving 36 408694 MARSDEN MARSDEN © 2021 Marsden Services www.marsden.com Our goal is to be transparent, collaborative, and responsive. A core part of Marsden’s operating model is empowering our local leadership teams with the autonomy to provide the highest level of service. As part of this practice, we always provide our clients with the names and contact information of their local Marsden leadership. Our local team is available to answer questions, address concerns, respond to requests, and to respond to emergency needs. Comprehensive Communication Direct Contact Clients are always given their account manager’s contact information. Clients can also request scheduled calls. Reports & Surveys We can provide results from inspection reports and clients can send us surveys and reviews of our service performance. We believe that intentionally initiating communication establishes better partnerships as we improve our understanding of your priorities and develop the ability to anticipate your facility needs. Marsden takes a proactive approach to managing communications. COMMUNICATION We have multiple communication platforms in place and tailor our com- munications to our clients, their teams, and their needs. Meetings Meetings can be scheduled at regular intervals or upon request and can include various representatives from our team and the client’s team. Onsite Visit We can meet with clients onsite during site inspections, site visits, client tours, or for other onsite events. Client Portal We can create a customized client portal that allows you to see inspection reports, service schedules, and real-time metrics. Client Care Center Our clients have 24/7/365 access to our Client Care Center for service requests, crisis situations, and questions. 37 409695 MARSDEN 0 MARSDEN © 2021 Marsden Services www.marsden.com HIRING PRACTICES We hire with an eye on building a long-term team. Marsden seeks to not only hire the best staff, but to retain our associates and help them grow in their careers at our company. Strengthening our culture by recruiting, hiring, and retaining the best associates. Hiring Methods Marsden has a unique approach to hiring. We combine recruiting, hiring, and onboarding practices that blend the speed and efficiency of technology and e-onboarding with the personal touch of face-to-face interactions. Our comprehensive hiring process guarantees our clients get qualified long-term associates, increased productivity, and the highest level of quality in the way we care for our client’s workspaces. Our intensive screening and hiring processes go well beyond industry standards because we know that finding the best associates to care for your workplace is what distinguishes Marsden from its competitors. Our hiring is done by our HR Talent Acquisition Specialists, who are experts in current employment laws, verifying authorization to work documents, running E- verify checks, performing background checks, and interviewing candidates. Marsden’s careful hiring process results in a quality workforce that is highly trained, trustworthy, and motivated. Talent Acquisition The Talent Acquisition Specialists create well-defined job descriptions. They advertise positions on online platforms, social media, community outreach, and a successful referral rewards program with our existing staff. We find the best applicants and review their qualifications. 1 38 410696 MARSDEN Screening We vet each applicant’s eligibility, legal status, work history, and background. We also implement additional screening measures dependent upon specific job and client requirements, including drug and alcohol testing, driver’s record checks, strength testing, and education verification. 2 Interviewing Qualified applicants participate in personal, face-to-face interviews that cover general suitability, job experience, and work ethic. With a combination of standard questions and position-specific discovery, our experts can effectively determine if the candidate will succeed and remain with Marsden for the long term. 3 Hiring Marsden seeks associates interested in long-term opportunities with our company. During the hiring process, we provide associates with the training they will need to be successful in their Marsden careers. During onboarding, employees get to know Marsden’s culture and goals. 4 Retaining We engage our associates and help them grow in their careers. We provide competitive wages and benefits; promotions, training, and opportunities; recognition and awards programs; and associate engagement and care programs. 5 Internal Promotions Strategy Promoting from within is not just a best practice; it is a promise we make to our associates. Over 70% of our management personnel have been hired internally through promotions. We believe our associates stay committed when they see we are committed to helping them advance and reach their goals. Marsden’s internal promotions program, STEPS, clearly defines the requirements for advancement in the company. Marsden developed the STEPS program to provide our employees with an outline for career development. STEPS assigns each position a set of skills that must be mastered before moving to the next level. We provide training for associates who want to become qualified for a new position. © 2021 Marsden Services www.marsden.com HIRING 39 411697MMARSDEN © 2021 Marsden Services www.marsden.com TRAINING We investigate the best products, equipment, methods and cleaning systems, using the latest research and best practices to develop our training and quality assurance programs. Every Marsden team represents hundreds of hours of training and education. New Associate Training Every new Marsden associate goes through a multi-step training process. The result is a workforce that is knowledgeable, efficient, consistent, and highly skilled. Step One: Classroom Training The first portion of the training program takes place at one of our offices. Classroom training focuses on company policies and procedures, associate “Right to Know” information, safe use of all products and equipment, and environmentally conscious cleaning techniques. There are test questions after each section to ensure comprehension. 1 Step Three: Technical Training The final stage in our training program is for associates begin their onsite technical training, which includes standardized cleaning methods, site-specific training, equipment training, periodic work training, safety protocols, human resources policies, and customer service training. Step Two: Procedural Training Associates receive one-on-one instruction during procedural training. During the hands-on training, a designated trainer works alongside the new associate. As they clean, the new associate is taught Teach Easy Cleaning Habits (TECH), Marsden’s unique cleaning system. 3 2 40 412698 MARSDEN How it works Tasks TECH specifies everything that needs to be done and the order in which to perform each task. Route Associates are taught the most efficient path and cleaning method for each area. Supplies TECH incorporates the best equipment and chemicals to use for each application. Consistency TECH eliminates variables from one associate to the next, ensuring uniform performance. Efficiency TECH’s best practice method for cleaning each area ensures time and energy are not wasted. Ownership Associates understand their responsibilities and how their work contributes to the overall success of the team. Why it matters © 2021 Marsden Services www.marsden.com In addition to the initial training programs, all of our staff are expected to complete ongoing training and annual refresher training courses. Our labor management software system has a compliance component to track training. Our system monitors and records that team members have received the proper training and certifications for their positions. The system automatically informs management of upcoming training due dates and provides alerts for past due items. TECH System and Training Marsden’s Teach Easy Cleaning Habits (TECH) program is a proprietary system designed to ensure reliable quality standards. TECH teaches new associates our standard cleaning system as well as the specific scope of work for the account where the associate will be working. TRAINING 41 413699MARSDEN © 2021 Marsden Services www.marsden.com Marsden's management processes continually monitor associate compliance with our uniform and appearance policies ensuring clean, well-groomed personal appearance on every client job site. • Daytime associates • Nighttime associates Professional Standards We offer high-quality uniforms to our associates free of charge. They are required to wear uniforms and photo identification cards whenever they are on the job. Our uniforms serve as identification and ensure our associates make a positive impression and provide a higher level of security for our clients. If an associate leaves our employment, we hold their last paycheck until they return their identification card. We can customize our uniforms to meet specific client requests and correspond with associate job responsibilities. Our uniforms typically cover four types: • Project specialists • Management UNIFORMS & IDENTIFICATION Our associates must maintain high professional standards in every aspect of work. We require our associates to maintain uniform and appearance standards and accountability when providing care for our client's workplaces. 42 414700MARSDEN © 2021 Marsden Services www.marsden.com SAFETY FIRST Our national environmental health and safety leadership team monitors and introduces initiatives to ensure our associates receive the latest safety training to come to work careful, alert, prepared to provide clients with cleaner, safer and healthier workplaces. Our goal is ZERO injuries. Marsden has a culture of safety, and every associate is passionate about providing our clients and our staff with a safe and healthy environment. Marsden associates make safety part of their lifestyle and integral to every task and operation they perform. Marsden’s Safety360 program is a behavior-based program supporting associate well-being. The Safety360 program is a comprehensive, proactive, and multidimensional initiative that our national and local safety leadership teams use to build a company-wide safety culture. Marsden’s Safety360 Program . We focus on prevention-based activities to ensure Safety360's success. Safety360 includes the following vital fundamental elements: • Behavior-based program of risk exposure, hazard identification , incident prevention, and rewards • Well established and communicated goals • Mandatory Personal Protective Equipment requirements • Daily pre-shift hazard identification and control conferences • Continuous task-specific training • Developing field safety leaders as crucial extensions of the Safety360 program • Near-miss incident reporting and investigation • Detailed incident investigation and root cause analysis • Scheduled safety audits 43 415701 MARSDEN © 2021 Marsden Services www.marsden.com Hazard Control Methods As a fundamental practice, we adhere to the hazard control methods established by the National Institute for Occupational Safety and Health (NIOSH): Substitution Replace the hazard Engineering Controls Isolate people from the hazard Admin Controls Change the way people work PPE Protect associates with PPE Elimination Physically remove the hazard Continuous Safety Training Training is the key to creating and maintaining safety awareness throughout our company. Marsden's Safety360 program provides ongoing training for our associates, continuing throughout their careers. Associates receive safety awareness training upon hire, where they are required to review Marsden Services' Cardinal Rules of Safety, sign the Safety Pledge, and complete Employee Right-to-Know training. Following this initial training, associates receive supplementary training on identifying and reporting workplace safety hazards before beginning work in their assigned accounts. For each account, we conduct a site-specific hazard analysis which leads to site-specific training protocols. Training is reinforced through daily safety briefings at the job site to provide ongoing protection for our associates and our clients. Our managers are a key to our consistent focus on safety. Every Marsden manager completes advanced-level safety training modules. During training, new managers review the full safety spectrum, from the basics of safe practices to the audit protocols following any safety incident. Supported by Marsden's compliance tracking technology applications, managers – including our safety directors, coordinators, and supervisors – are responsible for their associate's ongoing training and compliance. SAFETY FIRST 44 416702MARSDEN © 2021 Marsden Services www.marsden.com QUALITY CONTROL Marsden's quality assurance program comprises three key aspects: a thorough and proactive program, innovative technologies, and industry-leading labor management techniques. Quality assurance is the foundation to all aspects of our service delivery. Marsden empowers our associates to provide consistent, reliable, and customer-focused services. We are constantly exploring ways to improve the condition and value of each client facility. We use predictive analytics to provide consistent quality services while we continue to focus on containing costs for our clients. Before working in an account, our leadership team discusses priorities with our clients and together we determine key performance indicators (KPIs). Marsden’s Quality System Marsden’s quality control program covers nine key pillars. Timekeeping HR Access Health & Safety Project Calendar Reporting Customer Surveys Service Requests Inspections Work Order Tracking 45 417703 MARSDEN 1 © 2021 Marsden Services www.marsden.com QUALITY CONTROL Our web-based quality control platform enables us to establish and monitor the necessary metrics to be successful, which includes the following: - Well-trained staff - Disinfection and cleaning results - Facility inspection performance scores - Service deficiency resolution - KPI compliance - Training levels - Safety program compliance - Customer engagement - Identifying opportunities for improvement - Cost containment Labor Management Marsden uses the latest mobile technology to streamline our HR efforts and efficiently manage our labor force from the field. From a mobile device, Marsden supervisors can manage people and projects from any location. Managers leverage mobile technology to: • Monitor associate departures and arrivals in real-time • Identify absences and contact available replacement team members • Communicate directly with team members • Perform site inspections and create reports • Ensure compliance with labor hours is delivered • View and fill open posts • Create, view, modify and share associates schedules • Monitor job schedules • Safety near-miss reporting • View associates pay stubs and hourly rates By using technology to streamline our HR efforts, our clients benefit from scalability and an increased level of efficiency and accountability. Timekeeping & Notifications and Human Resources Access 46 418704 Technology and Service Delivery Marsden uses a mobile project management system to track all service activities, manage work orders and specific service requests, and streamline communication with clients. The platform creates agility to accommodate the changing needs of our clients. Our work order service requests follow a simple five-step process that encompasses logging activities, providing progress communications, review and rapid escalation if necessary, and completion tracking and notification. Our procedures are monitored at the local and corporate levels, ensuring high levels of timely and quality follow-up. Marsden’s project management technology oversees a daily workload of periodic tasks occurring at various intervals. Leveraging their knowledge and experience, Marsden managers divide periodic tasks into reasonable and equal weekly workloads. Detailed weekly assignments ensure specific equipment and essential labor are available. We can also use this technology to track and identify areas for corrective action, including re-training, adding new associates, reformatting a schedule, new management, and/or adding equipment. Whenever a service request was a complaint, upon completion, we validate that we met client expectations and ask for feedback to ensure that service is again up to our client's standards. The corrective action plans are implemented into the project program, tracked for compliance, and documented in the project scope of work (SOW). © 2021 Marsden Services www.marsden.com Action items are first the responsibility of the account manager and are automatically escalated if they are not immediately reconciled at this level. Although we have a defined process for escalation, issues are almost always immediately resolved at the local level. LOCAL LEVEL AREA MANAGER DIRECTOR OF OPERATIONS CHIEF OPERATING OFFICER QUALITY CONTROL Service Requests, Work Order Tracking, and Project Calendars 47 419705 0 © 2021 Marsden Services www.marsden.com Marsden has three tiers of inspection, ranging from daily inspections done by onsite managers to quarterly formal inspections. Daily Informal Inspections Every day after each shift, onsite supervisory staff validate compliance with the tasks to be performed as outlined on the route card. Any discrepancies are corrected immediately. Monthly Formal Inspections The account manager performs monthly formal inspections. Client participation is optional. An official inspection form ensures each area of the facility is properly evaluated. Monthly inspection results are made available to the client. Quarterly Inspections Each account is inspected by an Operations Manager alongisde the account manager. Clients are invited to participate. Reports from these formal inspections are made available to all stakeholders. TIER 1 TIER 3 QUALITY CONTROL Quality Control Inspections and Reports Marsden's web-based and mobile quality assurance tools allow us to track and manage inspections. Our quality inspection platform is accessible to our associates via phone or tablet in the field. Mobility enables our managers to spend more time in the field, directly supervising the work done by our associates at each account. The quality assurance tool provides site-specific checklists and inspection forms and mobile devices can take photos and embed them in the inspection report. Our account managers can measure inspection reports against established quality goals and instantly respond with corrective actions, if necessary. We perform regular checkpoint inspections to review all aspects of Marsden's contract performance. Our client-established KPIs are given greater scoring weight, continually reinforcing our focus on the agreed-upon client priorities. During an inspection, we are examining the following aspects of our service performance: - Compliance with the SOW - Service levels by area category - Resolution of deficiencies - Disinfection effectiveness - Training effectiveness - Equipment readiness - Safety compliance - 5S Compliance Inspections TIER 2 48 420706 © 2021 Marsden Services www.marsden.com QUALITY CONTROL Transparent Metrics and Open Communication Every formal inspection report form is completed and logged in a centralized database. Our clients have access to all reporting. All client service requests are logged into our system and completion of that request is reported back to the client. Marsden can customize our reports to meet client KPI's and preferences. At the beginning of the contract period, we ensure that each client's KPIs are well understood by our team. We are performing a constant "gap analysis," which compares actual performance scores to the desired performance scores, which may result in a gap. If a gap exists between the actual and the desired level of service, we will continue to implement changes to improve performance until we have closed the gap. Client feedback is important to us. We can provide your stakeholders with a simple satisfaction survey on a quarterly basis. This survey helps us to measure our performance against client expectations. The surveys are customized to the KPIs of each specific program. Reports and Customer Surveys Site-Specific Safety Programs Our local management teams work with our clients to design and implement site-specific safety programs, tailoring training and stipulations to each environment. By doing so, we: - Create an accident-free culture - Ensure our employees go home as healthy as they arrived - Avoid property damage and increase the safety of client facilities - Provide safety assessments and near-miss reporting - Ensure compliance with all Federal and State regulatory requirements - Successful safety programs are an effective way to contain costs Environmental Health & Safety 49 421707MARSDEN © 2021 Marsden Services www.marsden.com With over 70 years of first -hand learning, Marsden's transition process has allowed us to perform thousands of successful account startups. TRANSITION PLAN Led by a team of cross-functional senior staff, implementation begins immediately upon notification of a contract award. Frequent and transparent communication is a central part of our process. The Transition Team The transition process starts with a thorough situational analysis,which we utilize to create a formal and systematic plan addressing specific needs and timelines.Our transition team includes professionals from HR,Operations,Sales,Training,Safety,and Administrative and Technical Services in order to ensure every detail is covered,including manpower,supplies,equipment,and all other essential resources.Our process is designed to ensure that transition phases and key dates are being met for a seamless startup.In our transition plan,we outline the essential activities to perform before,during,and after the transition.We customize our transition plan to meet specific client needs and timelines. New Start Checklist Job Site Name Job #Address Start Date City of South Miami TBD 6130 Sunset Drive, South Miami, Florida 33143 March 01, 2025 Start-Up Lead Coordinator Richard Wilson Sales Rep Shazard Ali Central Electronic File Location South Florida Office Ops Rep Ayza Mendoza The following transition plan is an outline for transitioning that anticipates 30 days'notice of service start,although Marsden can and has started service with less than 30 days'notice. 50 422708 ^/4 MARSDEN © 2021 Marsden Serviceswww.marsden.comTRANSITION PLANScheduled TaskOwnerWeek Before StartPre4321Start DayPostSalesObtain official award notificationHave contract reviewed by LegalFinalize contract negotiationsHave contract signed and sentSend info to the Start-up TeamSchedule internal team meetingsSchedule client team meetingsAttend initial start day (if possible)Tour site morning after (if possible)Monitor client satisfactionAttend start team meetingsOperationsReview contract requirements & bid docsCreate preliminary staffing planSubmit initial staffing requestsTour site(s) to complete account checklistClarify if client wants any existing staffFinalize staffing plan & adjust reqsInterview management candidatesSelect management personnelSubmit equipment requestsSubmit supply requestsSubmit uniform requestsSubmit IT requestsAssign extra start-up managersFinalize schedules & job runs w/Admin 51423709 © 2021 Marsden Serviceswww.marsden.comTRANSITION PLANScheduled TaskOwnerWeek Before StartPre4321Start DayPostOperations (continued)Assign sections to start-up managersAssign staff to start-up managersCentrally coordinate all efforts start nightConfirm all areas checked and securedTour morning after with site clientMaintain extra support until settled inAttend start team meetingsAdmin Support / National ActivityFill out any client required formsSend COI and W-9 to clientConfirm exact billing requirementsSet up billing with accountingOrder IT equipment - phones, computersOrder office supplies (if needed)Set up task schedules / job descriptionsSet up web WO SystemSet up web Periodic SchedulesSet up web Inspection SystemProvide web tool training if neededMonitor web tools & alert mgmt if neededContinue to support as neededAttend start team meetingsHuman ResourcesReview contract requirementsObtain staffing requests from OpsZip code search current for transfers 52424710 © 2021 Marsden Serviceswww.marsden.comTRANSITION PLANScheduled TaskOwnerWeek Before StartPre4321Start DayPostHuman Resources (continued)Zip code search applicants on fileInterview selected existing site staffPursue new applicants as neededInterview/screen all new applicantsSchedule mgmt interviews with OpsReview transfer list with OpsCheck applicant referencesMake job offers to applicantsPerform reference/background checksSchedule drug testing (if required)Perform new employee orientation trainingIssue uniforms, badge, handbook, etc.Start early in existing site if possibleProvide final staffing list to OpsSet up staff for call in (if applicable)Adjust/replace new staff if neededAttend start team meetingsSecurityReview contract requirementsConfirm exact access requirementsCoordinate special requirements with HRCreate any custom documentationConfirm Ops has a full understandingFollow-up on any security concernsAttend start team meetings 53425711 © 2021 Marsden Serviceswww.marsden.comTRANSITION PLANScheduled TaskOwnerWeek Before StartPre4321Start DayPostSafetyReview contract requirementsConfirm exact site requirementsCoordinate special requirements with HRCoordinate MSDS complianceConfirm Ops has a full understandingFollow-up on any safety concernsAttend start team meetingsSupplyReview contract requirementsConfirm exact site requirementsReview Ops supply requests & orderConfirm delivery to staging areaOrganize and set up suppliesAssist with staff trainingFollow up on any supply concernsAttend start team meetingsEquipmentReview contract requirementsConfirm exact site requirementsReview Ops Equip Requests & orderConfirm delivery to staging areaOrganize and set up equipmentAssist with staff trainingFollow up on any equip concernsAttend start team meetings 54426712AtMARSDEN © 2021 Marsden Services www.marsden.com Water and Storm Damage Mitigation We focus on containment and mitigation to limit losses and prevent the spread of damage. We use the latest technologies to avoid intrusion into other areas while quickly and properly drying any affected areas, enabling you to you reopen your business without the concern of mold or long-term damage. Fire and Smoke Cleanup Smoke can cause more damage to a building than is visible to the naked eye. We use industrial hygienic testing to determine the path and penetration of the smoke and use our findings to design a plan for the cleaning process. After cleanup is complete, we test again to ensure the area is safe for re-entry. Mold and Asbestos Remediation Mold damage is dangerous both to the facility and its occupants. We eliminate mold rapidly and completely, controlling any risk of mold spreading to different areas of your building. Our experts know how to identify and remediate mold or asbestos issues quickly and safely. We employ hygienic testing pre and post-cleanup to ensure safe re-entry. Document Recovery Marsden's document processing laboratories can recover documents that would have otherwise been deemed a total loss. Our laboratories are equipped with specialized technologies to remove water or moisture to recover your essential documents. We also provide thorough security measures to protect the business information and offer secure destruction of restored or unretained files. Restore Your Facility to its Pre-Loss Condition We understand that speed is essential when responding to a facility emergency and we offer 24/7 emergency response services. We also understand that the correct response is imperative. Our experienced restoration teams have the expertise to determine exactly what needs to be done to restore your facility to its pre-loss condition. We also work with your business asset teams to inventory and claim any assets lost. EMERGENCY SERVICES Fast and professional services that get you back in business quickly and safely. Marsden’s restoration division offers commercial disaster recovery, reconstruction, and remediation services that are fast, efficient, and safety-focused. 55 427713 MARSDEN M MARSDEN © 2021 Marsden Services www.marsden.com INTEGRATED SERVICES Facilities are complex environments, which is why Marsden provides integrated facility services. We support small and large businesses alike with comprehensive facility care. We get to know each of our clients individually and can provide a service package specific to their infrastructure and needs. Marsden offers a full spectrum of facility services to keep your facility clean, safe, and healthy. Instead of having multiple vendors to support different aspects of your facility, with Marsden, you can have a single provider to take care of all your facility needs. Marsden offers a seamless experience for your facility services. We provide a variety of service offerings, which support all aspects of facility operations and are divided into our five service lines. Marsden’s Five Service Lines JANITORIAL SECURITY MECHANICAL EMERGENCY RESPONSE Janitorial, disinfecting, carpet, window, floor, and other cleaning services Design and maintenance for HVAC equipment and electrical, plumbing and calibration services Uniformed guards, security technologies, investigations, remote guarding, and consulting services 24/7 disaster recovery and facility emergency services FACILITY SERVICES Comprehensive facility services for small to mid-sized buildings & campuses 56 428714 MARSDEN MARSDEN SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF, NOTICE WILL BE DELIVERED IN ACCORDANCE WITH THE POLICY PROVISIONS. INSURER(S) AFFORDING COVERAGE INSURER F : INSURER E : INSURER D : INSURER C : INSURER B : INSURER A : NAIC # NAME:CONTACT (A/C, No):FAX E-MAILADDRESS: PRODUCER (A/C, No, Ext):PHONE INSURED REVISION NUMBER:CERTIFICATE NUMBER:COVERAGES IMPORTANT: If the certificate holder is an ADDITIONAL INSURED, the policy(ies) must have ADDITIONAL INSURED provisions or be endorsed. If SUBROGATION IS WAIVED, subject to the terms and conditions of the policy, certain policies may require an endorsement. A statement on this certificate does not confer rights to the certificate holder in lieu of such endorsement(s). THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER. THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND, EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW. THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S), AUTHORIZED REPRESENTATIVE OR PRODUCER, AND THE CERTIFICATE HOLDER. OTHER: (Per accident) (Ea accident) $ $ N / A SUBR WVD ADDL INSD THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIOD INDICATED. NOTWITHSTANDING ANY REQUIREMENT, TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN, THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS, EXCLUSIONS AND CONDITIONS OF SUCH POLICIES. LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. $ $ $ $PROPERTY DAMAGE BODILY INJURY (Per accident) BODILY INJURY (Per person) COMBINED SINGLE LIMIT AUTOS ONLY AUTOSAUTOS ONLY NON-OWNED SCHEDULEDOWNED ANY AUTO AUTOMOBILE LIABILITY Y / N WORKERS COMPENSATION AND EMPLOYERS' LIABILITY OFFICER/MEMBER EXCLUDED? (Mandatory in NH) DESCRIPTION OF OPERATIONS below If yes, describe under ANY PROPRIETOR/PARTNER/EXECUTIVE $ $ $ E.L. DISEASE - POLICY LIMIT E.L. DISEASE - EA EMPLOYEE E.L. EACH ACCIDENT EROTH-STATUTEPER LIMITS(MM/DD/YYYY)POLICY EXP(MM/DD/YYYY)POLICY EFFPOLICY NUMBERTYPE OF INSURANCELTRINSR DESCRIPTION OF OPERATIONS / LOCATIONS / VEHICLES (ACORD 101, Additional Remarks Schedule, may be attached if more space is required) EXCESS LIAB UMBRELLA LIAB $EACH OCCURRENCE $AGGREGATE $ OCCUR CLAIMS-MADE DED RETENTION $ $PRODUCTS - COMP/OP AGG $GENERAL AGGREGATE $PERSONAL & ADV INJURY $MED EXP (Any one person) $EACH OCCURRENCE DAMAGE TO RENTED $PREMISES (Ea occurrence) COMMERCIAL GENERAL LIABILITY CLAIMS-MADE OCCUR GEN'L AGGREGATE LIMIT APPLIES PER: POLICY PRO-JECT LOC CERTIFICATE OF LIABILITY INSURANCE DATE (MM/DD/YYYY) CANCELLATION AUTHORIZED REPRESENTATIVE ACORD 25 (2016/03) © 1988-2015 ACORD CORPORATION. All rights reserved. CERTIFICATE HOLDER The ACORD name and logo are registered marks of ACORD HIRED AUTOS ONLY 12/18/2024 Marsh &McLennan Agency LLC 6160 Golden Hills Drive Minneapolis MN 55416 763-746-8000 MarsdenCertificates@marshmma.com Greenwich Insurance Company 22322 MARSDEN XL Insurance America,Inc.24554MarsdenSouth,LLC 11000 Wilcrest,Suite 125 Houston,TX 77099 Allied World National Assurance Company 10690 1160889533 A X 2,000,000 X 500,000 5,000 2,000,000 4,000,000 X X RGD943761812 1/1/2025 1/1/2026 4,000,000 A 5,000,000 X RAD943762012 1/1/2025 1/1/2026 C X X 10,000,000031410951/1/2025 1/1/2026 10,000,000 X 10,000 B B X N RWD943538912 (AOS) RWR943539012 (DE WI) 1/1/2025 1/1/2025 1/1/2026 1/1/2026 1,000,000 1,000,000 1,000,000 Workers Compensation policy (RWD943538912)includes Employers Liability coverage for the following Monopolistic States:Ohio,North Dakota,Washington and Wyoming Evidence of Insurance 57 429715 ACORD® Md*'' ADDENDUM No. 1 Project Name: JANITORIAL SERVICES RFP No. FN2024-17 Date: January 16, 2025 Sent: Fax/E-mail/webpage This addendum submission is issued to clarify, supplement and/or modify the previously issued Solicitation, and is hereby made part of the Documents. All requirements of the Documents not modified herein shall remain in full force and effect as originally set forth. It shall be the sole responsibility of the bidder to secure Addendums that may be issued for a specific solicitation. QUESTION #1 Will there be an opportunity to visit any of the sites on the bid? RESPONSE: A site visit/walkthrough/pre-bid is not scheduled at this time. Please refer to Attachment C, “Janitorial Service Locations Matrix,” and Attachment D, “Photographs of Floor Types in Service Areas,” in the solicitation for details of each facility identified for this project; including estimated Square Feet, Restrooms, Appliances, Sinks and Counters, Windows and Water Fountains. QUESTION #2: Who is the current contractor? RESPONSE: The current vendor is Clean Spaces, Inc. QUESTION #3: What is the current contract price being paid today? For each site? Date contract started? RESPONSE: The current monthly fee is $6,800 in total. We do not have a breakdown by each location. The current contract is based on a month-to-month basis. Please refer to the month-to-month agreement is attached to Addendum No.1. The current contract start date was October 1, 2021. QUESTION #4: Is the current contractor scope of work the same as the current bid scope of work? If not, what has changed? RESPONSE: No, the scope has changed from the current contract. New locations to the scope: • Indoor Basketball Gymnasium 58 430716 South 'Miami THE CITY OF PLEASANT LIVING • Dante Fascell Park – Restroom Facility QUESTION #5: How many hours per day per location does the cleaning crew work? RESPONSE: The number of hours worked is determined by the contractor and is based on the City’s requirements published in the Scope of Services. QUESTION #6: For Strip & Wax jobs, How many coats of wax per strip? How many coats of wax per Scrub? RESPONSE: The coats of wax per scrub are based on conditions and is determined by the Janitorial Services contractor. QUESTION #7: Who provides the chemicals for a strip & wax? RESPONSE: The contractor provides all required chemicals for strip & wax jobs. QUESTION #8: How many square feet of your floors is to be strip & wax in each building? RESPONSE: Refer to Attachment C, “Janitorial Service Locations Matrix” QUESTION #9: When we perform a strip & wax, would we be responsible for moving furniture? RESPONSE: The contract is responsible for moving furniture for strip and wax jobs. QUESTION #10: How many square feet is carpet? RESPONSE: Refer to Attachment C, “Janitorial Service Locations Matrix” QUESTION #11: What is the total square feet of your buildings? Each building? RESPONSE: Please refer to Attachment C, “Janitorial Service Locations Matrix,” and Attachment D, “Photographs of Floor Types in Service Areas.” QUESTION #12: Who supplies the cleaning supplies? RESPONSE: The contractor provides all cleaning supplies. 59 431717 QUESTION #13: Who supplies the paper & plastic,(toilet tissue, hand towels, hand soap) trash can liners? If contractor, what are the approx. previous or current cost? RESPONSE: The contractor provides all required supplies including but not limited to, the paper & plastic,(toilet tissue, hand towels, hand soap)trash can liners, etc. The cost of supplies and materials are included with the contractors monthly and annual fee for janitorial services. QUESTION #14: What hours are the current cleaning crew working? What days of week will we do service at each location? RESPONSE: Please refer to the Response to Question #5 and Attachment C, “Janitorial Service Locations Matrix for services hours and days of the week. QUESTION #15: What is your budget? RESPONSE: The annual budget for Janitorial Services is $130,000. QUESTION #16: Are there specific hours designated for cleaning? RESPONSE: Please refer to Attachment C, “Janitorial Service Locations Matrix, Pages 68 – 69 in the solicitation. QUESTION #17: Is there a Bond required? RESPONSE: No, a Bid or a Performance and Payment Bonds are NOT required. QUESTION #18: Will there be background requirements? If so, what is the level of background check required? RESPONSE: Please refer to the solicitation, “ATTACHMENT E - BACKGROUND SCREENING CHAPTER 435, FLORIDA STATUTES 435.04.” QUESTION #19: Are there any billable optional services. What were the annual billings for the optional services? RESPONSE: There may be requests for services that exceed the Scope of Services schedule such as additional carpet cleaning, floor striping and waxing, etc., that are billed individually and over and above the annual contract fee. QUESTION #20: Do we need to clean 2nd story or above exterior windows. 60 432718 RESPONSE: Yes, once per year at the Community Center. City Hall/Police 2nd floor, windows are cleaned on the inside only. QUESTION #21: Anticipated start date of service? RESPONSE: The estimated start date for service is March 15 to April. QUESTION #22: Any problems with any facilities who do we contact for repairs? RESPONSE: The Project Manager for Janitorial Services is the Public Works Department Assistant Director who will be the main contact for the contractor. QUESTION #23: Can i get a price list for each facility now. RESPONSE: Please refer to the Response to Question #3. QUESTION #24: What is the company name that is doing the cleaning now. RESPONSE: Please refer to the Response to Question #2. QUESTION #25: Paper Supplies will be delivered to every facility by the city or supply will be order by the city or the Vendor has to place order. RESPONSE: Please refer to the Response to Question #13. QUESTION #26: On 2.8. – Proposal Guaranty/ proposal Bond – each proposal must be accompanied by a proposal bond or cashier’s check in the amount of 5% of the proposal, in form provided (form 10). On bottom states that if the requirement for a proposal guaranty/ proposal bond is waived, the city will select box (the box is selected with an x) - question is I just want to make sure this is accurate no proposal guaranty/ proposal bond is required? RESPONSE: Please refer to the Response to Question #17. QUESTION #27: What is the value of the current contract for these services? RESPONSE: Please refer to the Response to Question #3. QUESTION #28: Are the custodians working on this contract members of a union? If so, which union? 61 433719 RESPONSE: To the City’s knowledge, the current custodians working on this contract are not members of an organized union. QUESTION #28: What is the contract start date for this project? RESPONSE: Please refer to the Response to Question #20. QUESTION #29: Are the service hours the window in which services are performed, or the required hours for service? For example, the Community Center service hours are Monday to Friday 6am to 12pm. Is the contractor required to provide 6 hours of service, or simply perform the required services between 6am and 12pm? RESPONSE: The contractor is expected to perform the services identified in the Scope of Services during the hours listed in Attachment C. QUESTION #30: In the RFP, page 16 item 2.8 indicates a proposal bond is required, however page 25 states a bid bond is not required for this project. Please clarify the bonds required for this project. RESPONSE: Please refer to the Response to Question #17. QUESTION #31: Is the contractor responsible for providing consumable supplies (paper, trash can liners, hand soap, etc.)? RESPONSE: Please refer to the Response to Question #13. QUESTION #32: We are inquiring on RFP-(RFP) No. FN2024-17-0-2024/SK, it is not clear if the square footage of the restrooms is included in the Square feet you provided on the RFP. RESPONSE: Yes, the restrooms are included in the square footage listed in Attachment C. For example, the Community Center restrooms are included in the square footage—2 restrooms downstairs (men and women) and 2 upstairs (men and women with showers). Attachment C also includes restroom square footage for the other facilities, that have restrooms, listed in Attachment C. QUESTION #33: Please clarify the meaning of “service hours” under section 3.2 Site Specifications and Location (p20). Does the use of the term mean the hours the buildings are operational/open to the public or does service hours designate the time identified for contractual cleaning of the building/facility? RESPONSE: Please refer to the Response to Question #29. QUESTION #34: Provide a count of bleachers in the gymnasium. 62 434720 RESPONSE: Individual bleacher counts are not available. The bleachers are connected and are located on each side of the court and fold out. The bleachers, there are 7 rows on each side of the gym . Total rows = 14 Each row sits roughly about 24 individuals, however that number can vary depending on the size of the person. Rough estimate = bleachers sit around 336 individuals. QUESTION #35 Confirm that cleaning of parking lots and exterior grounds are EXCLUDED from this RFP. RESPONSE: Yes, cleaning of parking lots and exterior grounds are EXCLUDED from the Scope of Services. QUESTION #36 Provide an estimated occupancy count or occupancy percentage for each building in the RFP. RESPONSE: The City does not have an occupancy count or occupancy percentage available. QUESTION #37: To ensure maximization of resources, can the Police building, Sylva Martin and Public Works buildings be proposed for evening cleaning? RESPONSE: Please refer to Attachment C, “Janitorial Service Locations Matrix, Pages 68 – 69 in the solicitation and the services hours for each location. QUESTION #38: Under section G Bi-annual Service (p23) confirm that the City is requesting the interior and exterior cleaning of ALL windows of the 6 buildings RESPONSE: Please refer to the Response to Question #2. IT SHALL BE THE SOLE RESPONSIBILITY OF THE BIDDER TO SECURE ADDENDUMS THAT MAY BE ISSUED FOR A SPECIFIC SOLICITATION 63 435721 64 436722 South’Miami THE CITY OF PITASANT LIVING October 1,2024 Email:mg@cleanspaceonline.com Matt Giunco,CEO Clean Space,Inc. 3764 NW 124th Avenue Coral Springs,Florida 33065 Re:Notice of Intent to Terminate Agreement and Amendment to Term and Rates Effective 10/01/2024 -Service Agreement for Janitorial Services dated October 1,2024 between City of South Miami and Clean Space, Inc.(“Contractor”)(the “Agreement”). Dear Mr.Giunco: In accordance with the Agreement,the City of South Miami (“City”)intends to terminate the Agreement early effective on or before March 31,2025,or within the next six months,and hereby agrees to amend the term of the Agreement to provide for a month-to-month term for a period of six months commencing October 1,2024 (the “Month-to-Month Term”).The City agrees to provide Contactor with 30-days advance written notice prior to the final termination date. The City hereby agrees to amend the Contract Price or monthly rate during the Month-to- Month Term,or until sooner terminated by the City,from $4,341.00 to $6,800.00 per month, effective October 1,2024.The Contractor shall continue to provide the Services on the same terms and conditions as required in the Agreement,with the exception of the monthly rate as amended herein. Per your letter attached,the Contractor has agreed to early termination of the Agreement, the Month-to-Month Term and the amended monthly rate.Please confirm acceptance and agreement to the terms of the letter and amendment to the Agreement by signing and acknowledging below. Should you have any questions regarding this matter,please feel free to contact me. Sincerely, cc:City Attorney Agreed to and Accepted By: Clean Space,Inc. Name &Title:^/7^0^,C&j Date:/g ///-2-^ Genaro “Chip”Iglesias,City Manager 65 437723 CLEAN SPACE INC. 3764 NW 124TH AVE CORAL SPRINGS FL,33065 CONTACT: 800.499.0116 CLEANSPACEONLINE.COM CleanSpace Commercial Cleaning Re:Upgrading monthly janitorial contract on a month-to-month basis To Whom It May Concern, Please accept this letter as confirmation of our intention to increase our monthly rates from the current amount of $4,341.00 per month to the new amount of $6,800.00 per month,effective October 1st. We understand that the City of South Miami will open bids again for this contract.We agree to maintain the current contract structure on a month-to-month basis for a maximum period of six months,from October 1st,2024,to March 31st,2025. Please do not hesitate to contact me if you require any further information or insights regarding Stephanie's qualifications and achievements.I can be reached at 954-880-5188 or mg@cleanspaceonline.com. Matt Giunco CEO Clean Space,Inc. CLIENTPOINT DOWNLOAD RECEIPT ------------------------------------------------------------------- DOWNLOADED: 01-22-2025 CLIENTPOINT ID: 1120040 438724 CITY OF SOUTH MIAMI REQUEST FOR PROPOSALS (RFP) No. FN2024-17 JANITORIAL SERVICES ¾¾-w¾Uwيژ Steven P. Kulick City of South Miami Chief Procurement Officer %Åw°يژ׎׎אאד׎והאژ G-ژ%-يژהדÅדژ Å-Uژٮژ¨-Fוwe¾FhÞÝח ÞÞÞِOUGOuUw¾-ww-°-¨ÝU-°ِu °ɓƨȂǠɋɋƷưژ ɋȏ: CITY OF SOUTH MIAMI °ɓƨȂǠɋɋƷưيژJanuary 23, 2025ژوژ׏0ي׎׎ AMژ 6130 Sunset Drive South Miami, FL 33143 7KLVTXRWHLQFOXGHVGDWDWKDWVKDOOQRWEHGLVFORVHGRXWVLGHWKH*RYHUQPHQWDQGVKDOOQRWEHGXSOLFDWHGXVHGRUGLVFORVHGLQZKROHRULQSDUWIRUDQ\SXUSRVH RWKHUWKDQWRHYDOXDWHWKLVSURSRVDO,IKRZHYHUDFRQWUDFWLVDZDUGHGWRWKLVRIIHURUDVDUHVXOWRIRULQFRQQHFWLRQZLWKWKHVXEPLVVLRQRIWKLVGDWDWKH *RYHUQPHQWVKDOOKDYHWKHULJKWWRGXSOLFDWHXVHRUGLVFORVHWKHGDWDWRWKHH[WHQWSURYLGHGLQWKHUHVXOWLQJFRQWUDFW7KLVUHVWULFWLRQGRHVQRWOLPLWWKH *RYHUQPHQW¶VULJKWWRXVHLQIRUPDWLRQFRQWDLQHGLQWKLVGDWDLILWLVREWDLQHGIURPDQRWKHUVRXUFHZLWKRXWUHVWULFWLRQ7KLVUHVWULFWLRQDSSOLHVWRDOOSDJHVRIWKLV SURSRVDOPDUNHGZLWK³XVHRUGLVFORVXUHRIWKLVTXRWHGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVTXRWH´ °ɓƨȂǠɋɋƷưژƨɲي OǠǒǚژuƌǠȄɋƷȄƌȄƩƷژ°ƷȵɫǠƩƷȽ גבז׎ژ °ÞژוגɋǚژÝ- uǠƌȂǠًژFkژבב׏דד וژזژהژٮژבژדژ׎ژٮژבژחژדژז U%°ۮOUGOuUw¾-ww-°-¨ÝU-°ِu 439 South ’Miami THE CITY OF PLEASANT LIVING ABOUT US CAPABILITIES COMPANY DATA ¥UkU¾-°ژ°¾¾-u-w¾ Janitorial - NCAIS 561720 Disinfection - NCAIS 561720 Construction clean up - NCAIS 561720 Maintenance and repairs - NCAIS 561210, 561700, 238220, 238210 Logistics and warehousing - NCAIS 493100 Transportation, drivers and chauffeurs - NCAIS 485000 Cook service and kitchen management - NCAIS 722310 IT support, software development, cyber security, internet, IP Phone, surveillance system planning and installation, collocation, Fiber optic line installation - NCAIS 541511, 541512, 541513, 541519 Procurement and purchasing support for most commodities - NCAIS 561110, 541611, 811310 Security services - NCAIS 561600, 561612 Landscaping services - NCAIS 561790 Marketing and Public Relations - NCAIS 541613, 541800 Inspection and quality assurance control methods HR services (i.e. payroll services, recruiting and support through administrative and general management) - NCAIS 541612 Graphic Design - NCAIS 541430 CONTACT 4380 SW 74th Avenue Miami, FL 33155 786-350-3958 https://www.highmaintenanceservi ces.com/ info@highmaintenanceservices.co m CAGE - 65CU5 19GT5022D0018-19GT5022F0532 UEI - REF7NJTFKWV9 CONTRACTS Department of State U.S Embassy Guatemala DATA DUNS - 002250762 Founded in 2004 by a single mother and her son, our business began in a HubZone, an economically distressed community. As a minority-owned company, we focus on empowering our carefully chosen team by providing the resources, guidance, and support they need to excel. Our team goes above and beyond for our clients, motivated to deliver exceptional service. We offer scalable services and are committed to providing clients with trusted employees. In today's competitive environment, we strive to retain talent and create opportunities for a brighter future. While janitorial services are where we started, our mission goes beyond cleaning. We aim to recognize and nurture each team member's unique skills, helping them grow and achieve their full potential. Our focus is on making the most of today while building a better tomorrow. CLICK TO LEARN OUR STORY 440 SCAN ME èé èê èë èì èí èî èï èð èñ éè éé éê éë éìčéî éï éð 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 7DEOHRI&RQWHQWV èé è0 Cover Pages and Impact Presentation d±ĘÂĘ$8P 0ÝĘI¾Â±««¤ĘLÂÍª UsªĘ0ÝĘ ±«ÈsÈÂ ?¾s«âsÈ±«s¤Ę s¾ÈĘ ?Í¾Ę ±ª»s«ÝĘ Í¤ÈÍ¾Ę ª»¤±ÝĘ«ÈÂĘ &««ÈÖĘI¾±¾sªÂ Ü»¾«Ę9 Ę ÍsÈªs¤s Ü»¾«Ę ±«ÂÍ¤sÈĘ ±¤±ª~sĘ Ü»¾«Ę¤ÈÂ L¾«Ę2ÈÈ¾Ę9 Ę ÍsÈªs¤s L¾«Ę2ÈÈ¾Ę2U&P L¾«Ę2ÈÈ¾ĘsĘ$¾ÈsĘU¾ÍÂÈ «s«s¤ĘLÂ±Í¾ÂĘ÷÷Ęs«Ę ¤±±Ę~±¾«ĘIsÈ±«ÂĘU¾s«« Â«È±«Ę?»È±«Â 441 éñ êè êé êê êë êì êíčëè ëé ëê ëë ëì ëí ëî ëï ëð ëñčìè ìé «ÈĘL»±¾È« ÈÖĘP8ĘLÂÈ¾sÈ±« I¾±±Ę±Ę&«ÂÍ¾s« ªs¤Â 8¾±~¾ĘU«±¤±Ý PsÈÝĘsÈsĘPÈÂ ½Í»ª«ÈĘI¤s«Ęč 8s«sª«ÈĘ»»¾±s »»¾±sĘÈ±ĘÍÂÈ±ª¾ĘÂsÈÂsÈ±«ĘíĘÂÈs¾Ę¾sÈ« 0ÝĘI¾±¾ªs«Ę&«sÈ±¾Â U¾s«ÂÈ±«ĘI¤s« KÍs¤ÈÝĘ ±«È¾±¤Ę&«Â»È±¾ÂĘI¾±¤ KÍs¤ÈÝĘ ±«È¾±¤ĘI¾±ÂÂ LÂ»±«ÂĘ»¾±ÂÂĘÈ±Ęª¾«ÈĘ¤s««Ę±«¾«Â ±¾¾ÈÖĘÈ±«ĘI¾±ÂÂ &ª»¤ª«ÈsÈ±«ĘÈsÂ¢Ę±¾Ęč Ü»ÈsÈ±«ÂĘªÈ« 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 7DEOHRI&RQWHQWV 442 ìê ìë ìì ìíčìî ìï ìð ìñčíé íêčíï íðčî1 î2čî3 î4čîî îïčîðĘ îñı $8PĘÍ¾«ÂĘ8sÈ¾s¤Â ª»¤±Ýª«ÈĘP¾««ĘL½ÍÂÈÂ U¾s««Ę?Ö¾Ö× U¾s««ĘI¤s«Ęč ª»¤±ÝĘ&«ÈsÈ±«Ęs«ĘZ«±¾ªÂ PÍÂÈs«s~¤ÈÝĘ?¾ ĘLIĘI¾±¾ªs«ĘÜ»ÈsÈ±«ÂĘs¾ÈĘĘčĘ I¾±»¾Ès¾ÝĘÈ«±¤±ÝĘs«Ęs»»¤sÈ±«ÂĘč Pª»¤ĘU¾s««Ęs«ĘÖ¤±»ª«ÈĘI¤s« PROPOSAL REQUIREMENTS LOI FORM PACKAGE FORM PACKAGE FORM PACKAGE 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 7DEOHRI&RQWHQWV 443 NEW US JOB OPPORTUNITY MAINTAINS AND SUPPORTS CURRENT ADMINISTRATIVE AND CONTRACT MANAGEMENT OF CURRENT HMS STAFF. INDIRECT JOBS VIA LEGAL, AND BUSINESS PROFESSIONALS. US BASED SOFTWARE DEVELOPERS WORKING WITH HMS TO MAINTAIN AND GROW IT'S SUITE OF PROPRIETARY SOFTWARE APPLICATIONS. LEED(19,5210(17$/ CONSULTANT(48,30(17&+(0,&$/(;3(57$1' 26+$&2168/7$17352)(66,21$/6 THROUGH THE DURATION OF THIS SERVICE CONTRACT, THIS OPPORTUNITY CREATES AND MAINTAIN6: 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO444 H igh Standards -High Performance - High Maintenance Government˙˔˖˜˟˜˧˜˘˦ ˥˘ˣ˥˘˦˘ˡ˧ ˧˛˘˙˜˥˦˧ʼˀ˃˅ʸˆˆʼ˂ˁ ˢ˙˪˛˔˧˧˛˘ˈˡ˜˧˘˗ˆ˧˔˧˘˦˜˦˔˟˟˔˕ˢ˨˧ʡ O ur mission is to maintain that ʼˀ˃˅ʸˆˆʼ˂ˁ˔˟˪˔ˬ˦ʼˀ˃˅ʸˆˆʼˉʸʔ ˃˥ˢ˦ˣ˘˥˜˧ˬʸˤ˨˔˟˂ˣˣˢ˥˧˨ˡ˜˧ˬʽ˨˦˧˔ˡ˗ʹ˔˜˥˅˘˦˜˟˜˘ˡ˖˘ info@highmaintenanceservices.com 786-350-3958 786-345-3533 ÝU°Uw ˃˥ˢ˩˜˗˜ˡ˚˦˘˥˩˜˖˘˦˔ˡ˗˖˥˘˔˧˜ˡ˚˝ˢ˕ˢˣˣˢ˥˧˨ˡ˜˧˜˘˦˧˛˔˧ˣ˥ˢ˨˗˟ˬ˦˘˥˩˘ ˔ˡ˗˥˘ˣ˥˘˦˘ˡ˧˧˛˘ˈˡ˜˧˘˗ˆ˧˔˧˘˦ˢ˙ʴˠ˘˥˜˖˔˔˥ˢ˨ˡ˗˧˛˘˪ˢ˥˟˗ʡ Lead by example with United States based operating procedures, training, implementation and service management. 4380 SW 74th Avenue Miami FL 33155 e-¾UÝ- ˊˢ˥˞ʿ˜˙˘ʵ˔˟˔ˡ˖˘ˊ˘˟˟ʠ ʵ˘˜ˡ˚ʴˣˣ˥˘˖˜˔˧˜ˢˡ 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 445 Pr©wo^o©g ©od ©r@©ftmg J©fe ©pp©^™^©©^h©^pc3©©^ ©©dl ©©pG3®®©©^Sh@ Oofed ©^towoi ©^©od ^h©w©d< O^PPEW©^©Ow©y©IWPiiWiS W@gp@o£y /I^o^^©^oUd®^©® W©^^Dm©®W@f =^©mg ★^pp/r©©ff©&ff©/ra ISSA Advancing Clean. Driving Innovation. GBAC GLOBAL BIORISK ADVISORY COUNCIL A Division of ISSA Building ServiceContractorsAssociationInternational Q STANDARDIZED PROCEDURES, SUPERVISION, CHEMICALS AND EQUIPMENT. Deﬁnition of Standardized Procedures. Since 2004, we haved tested and altered method of practice to perfection. Today we are able to deliver to our clients standardized procedures that are compliant with OSHA and other applicable safety standards to protect out employees and customers. Alterations in cleaning procedures must always be approved by HMS and must not place employee/customer safety at risk. CHEMICALS. For a separate fee HMS may provide chemicals that are proven to render the results our clients expect but also consider employee and customer safety. If customers require premium brand chemicals, HMS will accommodate pending customer reimburses HMS for the additional expense. SUPERVISION. Quality control is the only way to ensure the best results are generated. HMS ﬁrmly believes all employees must be supervised and trained to meet the needs of our customers. You are to expect routine visits/inspections weekly/bi-weekly from a ﬁeld supervisor that will be your main point of contact to manage the operations of your facility. EQUIPMENT Our commitment is to offer you the best practices, and consistent results. We are committed to always using the best and latest cleaning equipment available in the market. We will coordinate with company on equipment requirements. * ?9PZ 2U&9 HR Compliance Policy Development Policy Implementation Policy Enforcement Standardization 0 L?Z 9Ę $ 0 Employment Screening Clean Background/E-verify Experience UL&9&9 Ę9Ęc2?I89U Employee training OSHA and CDC Procedures Safety Certiﬁcations Z 9&?L8 Clean presentation Standardized uniforms Employee Identiﬁcation and badges 2 UL?PUU& Ę&P&9 U&?9 Fogger converts disinfectant into micromist Reaching deep into surfaces without damaging equipment Uses N-List disinfectant &U&?92ĘPLc& PĘc&22 Billed separately. Cleaning for special events Floor cleaning service Window cleaning Other Services available 9?UPö OUR SERVICES info@highmaintenanceservices.com 786-350-3958 786-345-3533 4380 SW 74th Avenue Miami FL 33155 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 4469 «s~¤ÂĘÂsª¤ÂÂĘ«È¾sÈ±«Ęs«ĘÍÂÈ±ª¾ĘÂ¾ÖĘ~ÝĘ~¾««ĘÈĘ ¡s«È±¾s¤ĘÂ¾Ö ±ÍÈĘ±ĘÈĘÂs±×ÂĘs«Ę~¾««ĘÈĘÈ±ĘÈĘ±¾¾±«ÈĘ~ÝĘ ªs¢«ĘÈĘsÂÂ~¤ĘÈ±Ęs¤¤ĘÍÂ¾ÂĘ×È«ĘsĘ~Í¤«ü Z»±«Ęs»»¾±Ös¤ĘKLĘ ±ÂĘs¾Ę»¤sĘ«ĘPÈ¾sÈĘ¤±sÈ±«ÂĘ«ĘÈĘ±æü d«ĘÂs««Ę±Ę×¤¤Ę¤sĘÈ±Ę$8PĘd~Ę»»üĘd¾ĘÍÂ¾ÂĘ×¤¤Ęæ«Ęs ¤ÖĘsÈĘ±¾ĘÍÂÈ±ª¾ĘÂÍ»»±¾È÷Ę½ÍÂÈ±«Â÷Ę~s¢Ęs«Ęs~¤ÈÝĘÈ±Ę»¤sĘ Â¾Ö¾½ÍÂÈü ?¾ ÍÂÈ±ª¾ÂĘs« ª»¤±ÝÂĘ¾sÂÂÍ¾s«Ę×ÈĘ±ÍÈĘ ¾ÈæsÈĘ±Ę Â«È±«üĘI¤sĘ«Ę¤ÝĘÖÂ~¤Ęs¾sÂĘĉs«ĘÂ«sÈĘ~ÝĘ ÍÂÈ±ª¾ĊĘsÍÈÍ¾«ĘsĘKLĘ±ĘÈsÈĘ×«ĘÂs««Ę×¤¤Ę±¾ĘÍÂ¾ÂĘª±¾Ę «±¾ªsÈ±«Ęs~±ÍÈĘÈĘÂ¾ÖÂĘs«Ę»¾±Í¾Âü ª»¤±ÝĘªs«sª«ÈĘÖsĘs»»¤sÈ±«Âü v d±¾¢Ę±¾¾Ę¾sÈ±«ü v êč×sÝĘ±ªªÍ«sÈ±«ÂĘs«Ę~s¢ü v UªĘªs«sª«È v UsÂ¢Ęªs«sª«È v s¤ÝĘ±»¾sÈ±«Ęs«ĘÈ¾s«Â»s¾«Ýü ±č~¾s«Ę×~ÂÈ ¾sÈĘ±¾ĘÍÂÈ±ª¾üĘsÈ±«s¤Ęs¾ÂĘªsÝĘs»»¤Ý* P±×sÂ«Ęs¤¤ ¤s««Ę±¾ÈÂĘÈ±ĘsÂĘs«ÜÈÝĘs«Ęs«Ę±æĘĘĘĘĘĘ ª»¤±ÝĘ±«æ«Ę«Ę±æĘ«Ö¾±«ª«ÈĘsÈÍ¾«ĘÖ±Â÷ĘÈ»ÂüĘĘĘĘĘĘ ±ª»s«ÝĘ»±¤ÂĘs«Ęs«±«Ýª±ÍÂĘ ?c&ĘsÂĘ¾»±¾È«ü v dsÈÂs»»Ę±¾ĘÍÂ«ÂÂ v 2Ö sÈĘÖsĘ×~ÂÈ v ªs¤ v 2±s¤Ę»±«ĘÂÍ»»±¾Èü v ª¾«ÝĘÂ»sÈü info@highmaintenanceservices.com 786-350-3958 786-345-3533 4380 SW 74th Avenue Miami FL 33155 Professionally Disinfected Of&(57,),&$7( ',6,1)(&7,21 86,1*+263,7$/*5$'(&+(0,&$/6 $1'352&('85(6 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO QASP Resources 4479 (67$%/,6+('%<$027+(5$1'621 0,125,7<2:1('6%$60$//%86,1(66 +($'48$57(56,10,$0,)/25,'$ 5($'<)2523(5$7,216:25/':,'( )2&86('2148$/,7<23(5$7,216 2850,66,217275$16)250$1'%5,1*2877+(%(672) 7+()$&,/,7,(6:(6(59,&($1'2857($00(0%(56 WHO IS HMS MIAMI èé 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 448 0 ê .H\3HUVRQQHO5HVXPH 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 449 JUAN CAMILO PEREZ EDUCATION Fall 2009-2010 Master’s in Public Administration Cum Laude Fall 2004 -2009 Bachelor's in Public Administration Summa Cum Laude Delta Epsilon Iota —Academic Honor Society Phi Alpha Delta —Pre Law Fraternity Florida Liternational University Florida Liternational University WORK EXPERIENCE September 2004 —Present Founder /President High Maintenance Services Miami,FL From the incorporation of this janitorial services company.Established and developed the Business Plan,rules and regulations,a mission statement and established busmess relations through networking to begin busmess transactions and handled development of service contracts. Oversees complete operation of the company including Contracts,and financial Developed procedure manuals,training guides,and overall in charge of personnel èë 9sÈs¤sĘ¾âs, MPA Telf Email Bio Juan PerezĘ, MPA čĘÍÂ«ÂÂĘª«ÂÈ¾sÈ±« Email Bio KEYTEAM v Masters Degree in Public Administration. v Experience in the private and public sector. v Logistics and Project Management Specialist. v Managing large teams and special events. NatyA@HighMaintenanceServices.com 786-350-3958 JP#+LJK0DLQWHQDQFH6HUYLFHVFRP 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO •Masters Degree in Public Administration. •Experience in the private and public sector. •Founder of HMS with 20 years in every janitorial business discipline. •Managing large teams and special events. 450 04ON/OFF SITE PU&9 Ęó 2sĘPÍ»¾ÖÂ±¾÷Ę¤È¾«sÈ÷Ę¤±±¾«ĘP»s¤ÂÈ÷ĘI? ÷Ęs¤¤ĘªÍÂÈĘ»¾±¾ªĘ¡s«È±¾s¤ĘÍÈÂü PositionPositionQtyQty/Ís«ĘI¾âI¾Â«ÈĘ8s¾ÈsĘ ±«âs¤âĘP~sÂÈs«Ę¾V IĘ?»¾sÈ±«ÂVs¤«È«sĘ8Í«±âJamilet VazquezI¾±ĘPs«â/s«È±¾s¤Ę?»¾sÈ±«Â/âs~¤¤Ę s¾s$LĘÂÂÂÈs«È/Ís«Ę ¾Íâ LÂk ±ª»¤s«¾¤Ę±ÂÈs¤±±¾«ĘP»s¤ÂÈ/sqÍ¤«Ę8s¾¾±qÍ« ?»¾sÈ±«ÂĘPÍ»¾ÖÂ±¾ sª¤sĘ¾¤sL¾ÍÈª«È/±¾Ę¾¤sPÈ±«Ęs«ĘPÈ¤ĘÜ»¾È ¾ÝÂÈs¤Ęosª~¾s«±&«È¾«sÈ±«s¤Ę?»¾sÈ±«ÂĘĘ8s«s¾$LP&«È¾«sÈ±«s¤ĘL¾ÍÈª«È2¤ĘLsj±Ý±Í«È«/ÂÂsĘÍ¾±IsÝ¾±¤¤ĘP»s¤ÂÈ/ÂÂsĘPÍs¾â¤¤«Vs«ÂÂsĘ¾È¾s« ÈÈ±¾«Ý6WDI¿QJ/HYHODQG3ODQVIĘ$Íªs«ĘLÂ±Í¾Â VP PsÈÝĘs«ĘK Ís¤ÈÝĘ ±«È¾±¤V I1Lead and Working SupervisorAlternate Working Supervisors11Flooring Specialist AlternateFlooring Specialist Lead2JanitorsHuman Resource Manager1Legal compliance Manager111POC Contract Manager8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO451 05 Our Company Culture 2XUPRVWLPSRUWDQWDVVHWLVRXU7($00(0%(56ZLWKRXWWKHP+06ZRXOGQ¶WH[LVW (PSOR\HH6DWLVIDFWLRQ5HFRJQLWLRQDQG%HQH¿WV3URJUDP .H\FKDUDFWHULVWLFVRIRXU RUJDQL]DWLRQDOFXOWXUH What makes a great work culture? PURPOSE SUCCESSAPPRECIATION WELL-BEINGOPPORTUNITY 1 Alignment to Company Objectives 2 A culture of appreciation 3 A culture of trust 4 Performance Focused 5 Resilience 6 Encompasses Teamwork 7 Integrity and transparency 8 Psychological safety 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 452 ONE OPPORTUNITY CAN CHANGE A FUTURE ! *SAVINGS ACCOUNT (CAJA DE AHORRO). *GROCERY VOUCHERS (VALES DE DESPENSA). BREAKROOM ESSENTIALS: WATER, COFFEE, TEA AND LIGHT SNACKS PROVIDED FOR EMPLOYEES. OSHA COMPLIANT FIRST AID KIT WITH ALL THE ESSENTIALS. OCCUPATIONAL HEALTH MONITORING. *EDUCATION BONUS AND CHILDCARE. ANNUAL EMPLOYEE APPRECIATION PARTY. EMPLOYER SPONSORED EVENTS LIKE BBQ, LUNCHES, AND ENROLLMENT IN FOR CAUSE LIKE MARATHONS OR EVENTS WHERE EMPLOYEES CAN PARTICIPATE AND HMS WILL WHOLE FUND OR MATCH FUNDRAISING TO A COMMON CAUSE ELECTED BY EMPLOYEES IE. 8L&922 ?L cUU2? 2 $L&Uj FREE DIRECT DEPOSIT AND EMPLOYER NEGOTIED FREE BANKING FOR EMPLOYEES (WHEN POSSIBLE). EMPLOYEE RETENTION PLAN THROUGH EMPLOYEE DEVELOPMENT 21(23325781,7<&+$1*(6(9(5<7+,1*(03/2<((6:,//%((1&285$*('72,19(67,1 7+(,53(5621$/'(9(/230(17,125'(572&5($7(23325781,7,(6)257+(06(/9(6 $W+06ZHXQGHUVWDQGWKDWZHPD\EHWKHVWDUWDQGVWHSSLQJVWRQHWRUHDFKJRDOV:HZDQWWRDFFHOHUDWH DQGFDWDSXOWWKHJURZWKWKURXJKRXWWKHGXUDWLRQRIWKHFRQWUDFW Example: $QHPSOR\HHGRHVQ¶WXQGHUVWDQGDQ\(QJOLVKEXWHQJDJHGLQRXUSURJUDPDQGOHDUQHGWR FRPPXQLFDWHRUEHFRPHÀXHQW :HZLOOLPSOHPHQWDSURJUDPWKDWFDSWXUHVWKHSRWHQWLDOLQHYHU\HPSOR\HHDQGRIIHUWKHPDJURZWKWUDFNE\ SURYLGLQJWKHWRROVDQGUHVRXUFHVQHFHVDUU\ 7KHJRDOLVWKDWWKHVWDUWDQG¿QLVK GXUDWLRQRIFRQWUDFWZH ZRXOG KDYHIRUPHGDZHOOURXQGHG WHDPWKDW FDQ VHHN HOHYDWHG RSSRUWXQLWLHV WR LPSURYH WKHLU TXDOLW\ RI OLIH DQG YLFDULRXVO\ RI WKHLU IDPLO\ ZKHWKHU LWV ZLWKLQ+06ourclientRUDQ\HQWLW\RIWKHLUFKRRVLQJ * Benefit may be pooled into one monthly performance bonus to assist employee with the expense. * Limitations apply in competitive bid contracts or lowest priced technically acceptable. Employee Benefits 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 453 [H*E1 (03/2<((5(7(16,213/$17+528*+(03/2<(('(9(/230(17 (03/2<((6:,//%((1&285$*('72,19(67,17+(,53(5621$/'(9(/230(17,125'(5 72&5($7(23325781,7,(6)257+(06(/9(6 $W+06ZHXQGHUVWDQGWKDWZHPD\EHWKHVWDUWDQGVWHSSLQJVWRQHWRUHDFKJRDOV:HZDQWWRDFFHOHUDWH DQGFDWDSXOWWKHJURZWKWKURXJKWKHGXUDWLRQRIRXUFRQWUDFW ([DPSOH$QHPSOR\HHGRHVQ¶WXQGHUVWDQGDQ\(QJOLVKEXWHQJDJHGLQa SURJUDPDQGOHDUQHGWR FRPPXQLFDWHRUEHFRPHÀXHQW v :HZLOOLPSOHPHQWDSURJUDPWKDWFDSWXUHVWKHSRWHQWLDOLQHYHU\HPSOR\HHDQGRIIHUWKHPDJURZWK WUDFNE\SURYLGLQJWKHWRROVDQGUHVRXUFHVQHFHVVDU\ 7KHJRDOLVWKDWWKHVWDUWDQG¿QLVKGXUDWLRQRIFRQWUDFWZHKDYHIRUPHGDZHOOURXQGHGWHDPWKDWFDQVHHN HOHYDWHG RSSRUWXQLWLHV WR LPSURYH WKHLU TXDOLW\ RI OLIH DQG YLFDULRXVO\ RI WKHLU IDPLO\ ZKHWKHU LWV ZLWKLQ +06HMS Client,3ULYDWHFRQWUDFWRURUDQ\HQWLW\RIWKHLUFKRRVLQJ ONE OPPORTUNITY CAN CHANGE EVERYTHING ,1&(17,9(352*5$06 PRESENTATION – PERFORMANCE – PUNCTUALITY – PRODUCTIVITY BONUSES v 3UHVHQWDWLRQ )UHHDQGXQOLPLWHG XQLIRUPV+LJK4XDOLW\FRPIRUWDEOHSDQWVVKLUWV VKRHVDQGVZHDWHUV $PRQJRWKHUFRPSDQ\VSRQVRUHGEUDQGHGPHUFKDQGLVHOLNHERRNEDJVWUDYHOPXJVDQGPRUH v 5HTXLUHG%HQHILWV +06LVRUZLOOEHHQUROOHGLQDOOSD\UROOWD[SURJUDPVRIIHUHGWRHPSOR\HHV v +HDOWK%HQHILWVReimbursement of +HDOWK,QVXUDQFHpremium up to $100 per month. v 3HUIRUPDQFH v 3URGXFWLYLW\ v 3XQFWXDOLW\ 0217+/<%2186(6 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 454 ([SHULHQFH 2XUFOLHQWVLQFOXGHWKHIROORZLQJ •U.S. Embassy in Guatemala City±+06SURYLGHVIXOOVHUYLFHMDQLWRULDODQG06*&RRN6HUYLFH IRUWKH1HZ(PEDVV\&RPSRXQGDQG2OG&KDQFHU\IDFLOLWLHV •Colombia Consulates in Miami and Orlando ±+06SURYLGHVIXOOVHUYLFH-DQLWRULDO 0DLQWHQDQFH5HSDLUV2SHUDWLRQV&KDXIIHU¶V&KLHIRI0LVVLRQUHVLGHQFHVWDIIDQG&DIHWHULD VWDIILQJ •Altis Cardinal±+06SURYLGHVMDQLWRULDOVHUYLFHVDWVTIWEXLOGLQJLQ&RUDO*DEOHVWKDW LVRFFXSLHGE\WHQDQW$PHULFDQ$LUOLQHV 2XUUHFHQWFOLHQWVDQGSURMHFWVDUHOLVWHGKHUHDVFDOODEOHUHIHUHQFHV U.S. Embassy Guatemala Client Name 86(PEDVV\*XDWHPDOD1(&DQG2OG&KDQFHU\ Place/s of Performance *XDWHPDOD&LW\*XDWHPDOD Point of Contact 'XDQH/DPEHUW)DFLOLW\0DQDJHU_3KRQH Period of Performance 3UHVHQW Value $SSUR[LPDWHO\86' Summary of Work Performed -DQLWRULDODQG&RRN6HUYLFH±DSSUR[LPDWHO\IXOOWLPHHPSOR\HHVRQ DYHUDJH Customer Feedback “Dear Mr. Perez: I would like to thank you and your team for the cleaning services of the common areas and the building in general provided by your company so that our new embassy was ready to receive all the staff on the first day of operations. The US embassy employee community reaffirms my appreciation and appreciation of the hard work and flexibility that HMS provided us, which led to an efficient and effective experience. Receive my best wishes because your activities continue to be carried out successfully. //William W. Popp Reference letter received from the U.S. Ambassador to Guatemala on February 16, 2023 provided in Appendix A. Issues/Difficulties and Resolution 1RNQRZQLVVXHVRUGLIILFXOWLHVUHTXLULQJUHVROXWLRQ2XUTXDOLW\RIVHUYLFH VWULYHVWRUHFHLYHNXGRVIURPRXUFOLHQWVPRQWKO\WKURXJKKLJKVWDQGDUGV FRQVLVWHQWWUDLQLQJDQGFRQVWDQWIROORZXSWRHQVXUHFRPSOLDQFH ZLWKLQWKHGHOLYHU\RIVFRSHDQG$4/¶VDVHYLGHQFHGLQRXUUHIHUHQFH OHWWHU 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 455 ([SHULHQFH 0LQLVWU\RI)RUHLJQ$IIDLUV0LDPLDQG2UODQGR&RQVXODWH Client Name &RORPELDQ0LQLVWU\RI)RUHLJQ$IIDLUVPXOWLSOHORFDWLRQV Place/s of Performance &RORPELDQ&RQVXODWHVLQ0LDPLDQG2UODQGR)ORULGD Point of Contact 0RQLFD7UXMLOOR_(PDLOPRQLFDWUXMLOOR#FDQFLOOHULDJRYFR_3KRQH_ Period of Performance 3UHVHQW Value &21),'(17,$/ Summary of Work Performed 0XOWLVHUYLFHSURYLGHURIMDQLWRULDOUHVLGHQFHVWDIIDQGFKDXIIHXU VHUYLFHV Customer Feedback 6LQFHZHKDYHHDUQHG\HDUO\UHQHZDOE\RIIHULQJWKHOHDGLQJHGJH RIVHUYLFHDQGLQQRYDWLRQ:HGHOLYHUWXUQNH\UHVSRQVHDQGVHUYLFHDW YDOXHSULFLQJ Issues/Difficulties and Resolution 1RNQRZQLVVXHVRUGLIILFXOWLHVUHTXLULQJUHVROXWLRQ2XUTXDOLW\RIVHUYLFH VWULYHVWRUHFHLYHNXGRVIURPRXUFOLHQWVPRQWKO\WKURXJKKLJKVWDQGDUGV FRQVLVWHQWWUDLQLQJDQGFRQVWDQWIROORZXSWRHQVXUHFRPSOLDQFH ZLWKLQWKHGHOLYHU\RIVFRSHDQG$4/¶V 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 456 ([SHULHQFH $/7,6&DUGLQDO Client Name $OWLV&DUGLQDO Place/s of Performance &RUDO*DEOHV)/ Point of Contact 0DUFR3HUH]_(PDLOPSHUH]#FDOWLVFDUGLQDOFRP_3KRQH Period of Performance &XUUHQW Value &RQILGHQWLDO Summary of Work Performed -DQLWRULDO Customer Feedback ³,KLJKO\UHFRPPHQG+06WRIDFLOLWLHVORRNLQJIRUH[SHULHQFHG GLOLJHQWDQGUHVSRQVLEOHSURIHVVLRQDOV:KHQLWFRPHVWR+06 6HUYLFHVZHDUHFRQILGHQWWKDWWKHSHUIRUPDQFHRYHUDOOLVUHVLOLHQW 7KURXJKRXUEXVLQHVVUHODWLRQVKLS+06KDVEHHQDUHOLDEOHVROXWLRQ WHDPZRUNZLWKHPSOR\HHVPDQDJHGHIHFWLYHO\DQGSURSHUO\LW VKRZVDKDSS\EXQFKDQGZLWKVROXWLRQVDWWKHLUILQJHUWLSVHYHQLQ WUDGHVWKDWDUHRXWVLGHRIWKHLUVFRSHRUOLQHRIEXVLQHVV7KH\DUH FHUWDLQO\WUDLQHGWRJRWKHH[WUDPLOH,QRWKHUZRUGV\RXFDQFRXQW RQ+06HPSOR\HHVDQGDGLOLJHQWPDQDJHPHQWWRJHWLWGRQH´ 0DUFR$3HUH]&KLHI(QJLQHHU706$OWLV 5HIHUHQFHOHWWHUUHFHLYHGRQ'HFHPEHUSURYLGHGLQ $SSHQGL[$ Issues/Difficulties and Resolution 1RVHUYLFHLVVXHV 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 457 5()(5(1&(/(77(56 86(PEDVV\ ±*XDWHPDODTRANSLATION 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO Reference Letters 458 Embassy of the United States of America Guatemala The Ambassador 16 de febrero de 2023 Senor Juan Perez HMS 4380 SW 74th Ave Miami,FL 33155-4406 Estimado Sr.Perez: Por este medio me permito agradecerle a usted y a su equipo por los servicios de limpieza de las areas comunes y del edificio en general brindados por su empresa para que nuestra nueva embajada estuviera lista para recibir a todo el personal el primer d ia de operaciones. La comunidad de los empleados de la embajada de Estados Unidos reafirma mi agradecimiento y reconocimiento del trabajo arduo y la flexibilidad que nos brindo HMS,Io cual propicid una experiencia eficiente y efectiva. Reciba mis mejores deseos porque sus actividades se sigan realizando con exito. Atentamente, Dear Mr.Perez: I would like to thank you and your team for the cleaning services of the common areas and the building in general provided by your company so that our new embassy was ready to receive all the staff on the first day of operations. The US embassy employee community reaffirms my appreciation and appreciation of the hard work and flexibility that HMS provided us,which led to an efficient and effective experience. Receive my best wishes because your activities continue to be carried out successfully). $OWLV&DUGLQDO 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO Reference Letters 459 12/27/21,1:51 PM IH^l High Maintenance Services Mail -Letter of Recommendation for HMS Juan Perez <jp@highmaintenanceservices.com> Letter of Recommendation for HMS 1 message Marco Perez <mperez@altiscardinal.com>Fri,Dec 17,2021 at 10:25 AM To:Juan Perez <jp@highmaintenancesen/ices.com> To whom it may concern, We've been working with HMS since 2010.Our relationship started when HMS was awarded a newly acquired property the 5040 building which is approximately 60,000 sq.ft.Present,our company Altis Cardinal,owns and operates 901 Ponce (American Airlines)building of 103,000 sq.ft,in Coral Gables. I highly recommend HMS to facilities looking for experienced,diligent and responsible professionals.When it comes to HMS Services we are confident that the performance overall is resilient.Through our business relationship HMS has been a reliable solution,teamwork with employees managed efectively and properly (it shows,a happy bunch)and with solutions at their fingertips even in trades that are outside of their scope or line of business.They are certainly trained to go the extra mile.In other words,you can count on HMS employees and a diligent management to get it done. Reach out if you have any questions. Respectfully, Marco A.Perez Chief Engineer TMS Altis 901 305 305 6693 Get Outlook for Android Dade Heritage Trust • 190 SE 12 Terrace, Miami, FL 33131 • 305-358-9572 www.dadeheritagetrust.org December 27, 2024 To Whom It May Concern: Please allow this correspondence to serve as a letter of recommendation for High Maintenance Services, whom we have contracted with to perform our facility maintenance services for the past six years. Their service is reliable and consistent, with employees going beyond their regular tasks to ensure a clean and healthy atmosphere in our building. I have served as the Executive Diretcor at Dade Heritage Trust since 2015. Prior to my employment here, I was the Diretcor at the Coral Gables Museum where I also utilized High Maintenance Services for the facility maintenance. I could have selected any vendor for maintenance at my new facility but chose to engage High Maintenance Services because of the quality of their services. I highly recommend them for your maintenance needs. Sincerely, Christine Rupp Executive Director 5(675,&7('3$*('21276+$5(25',6&/26( 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO ([SHULHQFH 460 Celebrating Fifty Years! DADE HERITAGE TRUST Preservation.Education.Advocacy. Hounded 1972 461 FINANCIAL RESOURCES WELLS FARGO DA DELAND BRANCH 7100 N KENDALL DRIVE MIAMI Fl 33156 we bfargoxom J PEREZ ENTERPRISES INC 4 380 5W 74th avenue Mia mi,FL 33155 To whom it may concern: This letter is to indicate that the Customer named above has the following deposit accounts with Wells Fargo Bank, N.A. HM5 has handled their depository accounts in a satisfactory manner and line of credit as agreed,while maintaining average depository balances in the high six figures with high credit and cash availability in the same range. We look forward to continuing working with HMS and assisting their growth throughout the aiming years. Please do not hesitate to contact us with any questions. This letter is provided on behalf of our dient without liability to the bank and /of its staff. Important Disclosures The recipient oft his information hereby acknowledges that WeiIs Fargo (“we",“us*Idoes not representor warrant that the information provided herein is complete or accurate,and any errors or omissions in the information shall not be a basis for a claim again st us.This information may not disclose the entire relationship the Customer maintains with us. This information issubjectto change at any time without notice.We are not obligated to notify the recipient ofany change Inth is informat on,or if any deposit account relationship referenced herein is.or is in the proces s of b elng,modified. termInated,or cancel led,unless we are required todoso by law or under the terms of the applicable deposit account agreement. This letter does not constitute a guaranty of future balances or credit support of any nature,nor do we accept any duty, responsibility,liability orobiigat ion that may arise from providing this letter,including any reliance upon the information or forany lossordamage that may result If you have any questions,pl ease contact me at:(305)253'1025 A representative will be happy to ass 1st you.as follows: Monday -Thursday:pen 900 AM Close 500 PM Eastern Time Friday:Open 9:00 AM Close 5:00 PM Eastern Time Saturday:Open 900 AM Close 1200 PM Eastern Time NMLS ID Use or disclosure of this data is subject to the restriction on the title kjio;page of this proposal. Use or disclosure of this data is subject to the restriction on the title page of this proposal. 14 Use or disclosure of this data is subject to the restriction on the title page of this proposal. I Intentionally left blank 462 Use or disclosure of this data is subject to the restriction on the title page of this proposal. I Intentionally left blank 463 %/22'%251(3$7+2*(1675$,1,1* (PSOR\HHDQGFXVWRPHUVDIHW\DUHRXU3ULRULW\ ,WLVLPSRUWDQWIRUXVWKDWHPSOR\HHVDUHDZDUHGHWHFWDQGSURSHUO\ SURWHFWWKHPVHOYHVDWDQ\H[SRVXUH26+$FRPSOLDQFHUHTXLUHVSXEOLF IDFLOLWLHVWRSURYLGHWUDLQLQJ7KHEHORZJXLGHRIIHUVLQVLJKWSHUWDLQLQJWR WKHWUDLQLQJLQSODFH 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 464 COVID-RELATED PROCESS HMS uses 2 methods of disinfection services 1 2 Electrostatic Disinfection Using only EPA registered disinfectants, Electrostatic Disinfection provides 100% Coverage Manual Disinfection Disinfection wipe down of all high-touch, vertical and horizontal surfaces. (Tables, desktop equipment, light switches, doors, doorknobs, etc.) Â«È±«ĘP¾ÖÂ 465 v $OOHPSOR\HHVDUHSURYLGHGZLWKDOLQNWRUHSRUWDFFLGHQWVQRPDWWHU KRZELJRU VPDOO v +06WUDLQVDQGJXLGHVHPSOR\HHVRQDFFLGHQWUHSRUWLQJDQGDVVLVWVLQ UHSRUW ZULWLQJIRUZLWQHVV v ,IDQHPSOR\HHLVLQMXUHGZHGLVSDWFKPHGLFDOWUHDWPHQWDQGUHSRUWWKH DFFLGHQWWR RXULQVXUDQFH $&&,'(175(3257,1* 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 466 $&7,9(6$0/eVerify 5(*,675$7,21 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 467 J.PEREZ ENTERPRISES,INC.•Active Registration O>View K Update Unique Entity ID:Doing Business As:Expiration Date REF7NJTFKWV9 JPEREZ ENTERPRISES INC Nov 04,2025 CAGE/NCAGE:Physical Address:Purpose of Registration: 65CU5 4380 SW 74TH AVE All Awards MIAMI,FL 33155-4406 USA More • E Verify Home Cases Reports Resources v My Company Account My Company Profile Company Information Company Name J.Perez Enterprises,Inc. Company ID 1848241 Employer Identification Number (EIN) 510527967 Doing Business As (DBA)Name High Maintenance Services Enrollment Date Jun 22,2022 Unique Entity Identifier (UEI) PROOF OF INSURANCE Use or disclosure of this data is subject to the restriction on the title page of this proposal. I 468 AmKD’CERTIFICATE OF LIABILITY INSURANCE KLATt iWMFDOXlTrri 24-25 PROOF THIS CERT1FIC ATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER.THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND.EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW.THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER^.AUTHORIZED REPRESENTATIVE OR PRODUCER,AND THE CERTIFICATE HOLDER. IMPORTANT:If the certUlcats he-kfer ts an ADDITIONAL INSURED,the policy (lea)muat have ADDITIONAL INSURED provisions or be endorsed. 11 SUBROGATION IS WAIVED,subject to the terms and conditions of the policy,certain policies may require an endorsement.A statement on tn la certificate does not center rights to the cartHicate holder in lieu of such endoraemant(a). FMDCUCtH LOK FACIhAVL. Lib&'ty Mutual Insurance !2?£H.n 000-962-7132 93D^43-36E6 POBM 1B8D&5 Emm*B JslreKServfce®JbenvM Ltua.c:n IN&JFS*|S|AFF CC4tfiA<iE NMC* Faffldd OH 45013 msuradM *Ohio Security insurance Company 240B2 iirajHtD j Perez EnlE-ipTses toe imsuim ib ow°Security insurance Company 24062 naa High MaintenanceIServices Hsmwe .Travelers indemnity CdOT Amedsa 25666 Pa Box:144591 IMSUWtM El . IMSUWtM It . Coral Gabies FL 33114 HSURMIt . COVERAGES CERTIFICATE HUMBER:REVISION NUMBER: THS B TO CERTIFY THAT THE POLICES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE =OR THE POLICY PERIOD INDICATED NOTWITHSTANDING .ANY RECSUREMENT TERM OR CONDITION 0=ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN.THE INSURANCE AF=CRDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS. EXCLUSIONS AND CONDITIONS OF SUCH ROUGES.LMRS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. IM&H LT TYPE OP INSURANCE raucr NJMHER I'OUC-hl 1 VV.UJr-YTT| I'UUC-tai'INNiliOT !UHIIS A X CfiMHEfedUU.uEhEfeAL llaBlRY X X BLSEQ27S773 1ifflz'iaaa 11/2772025 EA£H OCCURRENCE s LDOD.™ CiAiHS-WaLE X OCCUR -AWA-1 '1 :j 3DD.WD WED EXP lAiry AM piiw|S 15,000 FEfi iuNAl S WJV iMJLfiY S 1.D0D.DOC' <39il AtMRECSATE LlKT APPLIES PER SEHEfiW.MJLfitCit’rE i 2,1X10,0» X «UC¥||||LOS oTrfafi PftMLKTS-CfiMHOPAGG i 2,1X10,0)0 t 6 AUIOMUtMLE UAIMU FT EA5M27E773 11fiTJaOM 11/2772025 i 1,1X10.0» M¥jmn kcily in.uRy ;f«^i 1 OWNEDMraowr-ftEH AUTuS DM.Y SCa-tEDuLtCALTOS BCCIly IhuLfiY t X v NCH-C4ANEDAALTOSonly l*RCFERTY LAML9CE r-.'iJui1 s s JMHHLLLA L1AJ5 U-Ct55 LIAS OCCLfi EAiH OCCURRENCE s C1A1H8-MJDE Aj^ESATE + DED RETBYnDNt J C MDMKERE CaMI'EhBA'IU^ Mil tWLDYtB'UAH4U IT y ( AXTfT'HarWErDHJFWlMERlLRlXUirVt Mi4A UB2L7W553 D1.’D1i’2D2S D1/ni.*2026 t^TE EL-E^HACCMNT S IJMM.OaOorIICUK’NtNELItLACl |M«Utar/n MHi %AT»£«i bofcw el disease -ea employee s 1.DM.MD ’>iHS JmJCT U1l>MDESCRIPTCNOFCPS E L.DraEASE -PCUCY LMT i 1.COG,DOC abSCHrncmaF Cl'tHAFILWS iUOCAIIDHS .VhHICLfeS |ACU«D»I.AddllsnW llEiurcs Sclwtlila.twy HMatljKlMdiroien ipnliiraqulmi: ""Proof of insurance"" CERTIFICATE HOLDER CANCELLATION ACORD 25 (2M&103}The ACORD name and logo are registered marks of ACORD +06PDQDJHVDVWDQGDUGL]HGFRPSDQ\ZLGHFOHDQLQJWKURXJKFKHPLFDOV XVHGLQGDLO\FOHDQLQJRSHUDWLRQVWKURXJK'LYHUVH\FKHPLFDOV2WKHUFKHPLFDOV IURP'LYHUVH\PD\LQFOXGHFDUSHWFOHDQHUVDQGJUHHQVHDOGHJUHDVHU BENEFITS Green seal certiﬁed. Cost control. Accountability and consistent results. Streamlined employee training. CHEMICAL TYPES Neutral ﬂoor cleaner. Cleaner, disinfectant and deodorizer all in one. Glass cleaner. All purpose cleaner. êê 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO &+(0,&$/6 469 MICROFIBER TECHNOLOGY Microﬁber towels are proven effective in cleaning services. They can hold 5 times its weight, can absorb many chemicals like grease and oils. Does not leave behind dust or lint. Cleaning properties with effective application can help reduce bacteria by 99%. 216,7(252))6,7(/$81'5<6(59,&( $OOWRZHOVDQGPRSVVKRXOGEHZDVKHGUHJXODUO\WKLV KHOSVSUHYHQWFURVVFRQWDPLQDWLRQ,IVWDQGDUG ZDVKHUGU\HUFDQ WEHLQVWDOOHGZHZLOOSXUFKDVHDQG LQVWDOOSRUWDEOHXQLWV RED Restroom Cleaning GREEN Glass Cleaning BLUE General Cleaning 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 0,&52),%(57(&+12/2*< êë 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 470 6'6 +06PDQDJHVLWV6DIHW\'DWD6KHHWV WKURXJKDXQLTXHOLQNDVVLJQHGWRWKHFOLHQW 6'6%LQGHUVDUHQRORQJHULQXVH XQOHVVFXVWRPHUVSHFL¿FDOO\UHTXHVWRQHRQVLWH 7KH6'6ZHEVLWHGLJLWL]HVDOOGRFXPHQWVDOORZVRXUHPSOR\HHV FXVWRPHUVDQGLQVSHFWRUVWRUHWULHYHWKHPDWDQ\WLPHDQGREWDLQWKH ODWHVWYHUVLRQDOOZKLOHPDLQWDLQLQJ26+$FRPSOLDQFH êì 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 6$)(7<'$7$6+((76 471 ,QWKLVVHFWLRQ\RXZLOO¿QGDOLVWRIHTXLSPHQWFKHPLFDOVDQGVXSSOLHVWKDWZLOOEH XWLOL]HGIRUWKLVFRQWUDFW3OHDVHQRWHDOOHTXLSPHQWZLOOEHQHZ +06ZLOODVVLJQDQGFRPSHQVDWHDWOHDVWEXWKRSHIXOO\VWDIIPHPEHUVWRWUDLQZLWK HTXLSPHQWPDQXIDFWXUHURQHTXLSPHQWFOHDQLQJDQGPDLQWHQDQFH7KHVWDIIDUH H[SHFWHGWREHDEOHWRSHUIRUPPRVWPDLQWHQDQFHDQGUHSDLUVRQVLWHEHIRUHFDOOLQJD VSHFLDOLVW+06ZLOOSURYLGHDPSOHHTXLSPHQWLQFRQVLGHUDWLRQRIEDFNXSVWRDYRLG GRZQWLPH )RUPRUHWKDQ\HDUV+06DQG6WDSOHV)DFLOLWLHV$GYDQWDJHKDYHPDLQWDLQHGD EXVLQHVVSDUWQHUVKLS+06KDVDFFHVVWRWKHLUIXOOOLQHRUUHVRXUFHV6WDSOHV)DFLOLWLHV LVRQHRIWKHQDWLRQ¶VODUJHVWMDQLWRULDOVXSSOLHVDQGHTXLSPHQWGLVWULEXWHUV6WDSOHV IDFLOLWLHVLVDQLQGXVWU\OHDGHULQJUHHQFOHDQLQJLQLWLDWLYHV NILFISK ADVANCED FLOOR MACHINES RUBBERMAID MOP BUCKETS & MAID KARTS NILFISK ADVANCED VACUUM CLEANERS êí 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO (48,30(173/$1 472 NilfiskAdvance setting standards Rubbermaid Commercial Products 9DFXXP:HW 'U\ 4XDQWLW\ *DO&RPPHUFLDO:HW'U\9DFXXPZLWK7RRO.LW 1HSWXQH0XOWL6XUIDFH([WUDFWRU0XOWLVXUIDFH)ORRU&OHDQHU &DUSHWDOOIORRULQJDQGH[WUDFWRU 4XDQWLW\ 0XOWLVXUIDFHH[WUDFWRUZLWKWKHEHORZDFFHVVRULHVZLOOEHXVHIXOIRU GHWDLOVVXFKDVHGJHVJURXWOLQHVFDUSHW JKWVSDFHVVXFKDV XQGHUGHVNVDQGPRUH$OO0DGHLQWKH86$'HWDLOSRURXVVXUIDFHV *RRGEDFNXSWRPDLQXQLWWRPLQLPL]HGRZQ PH 7ULGHQW83+3URIHVVLRQDO8SKROVWHU\7RRO&DUSHW&OHDQHU0XOWL 6XUIDFH4XDQWLW\ 0RGHO +RVH8SKROVWHU\7RRO 7REHXVHGZLWK1HSWXQH0XOWLVXUIDFHFOHDQHU 7KLVWRROFDQEHXVHGIRUXSKROVWHU\VSRWFOHDQLQJDQGGHWDLOV 6KDUSVKRRWHU:DQG&DUSHW&OHDQHU0XOWL6XUIDFH 4XDQWLW\ /DUJHUDUHDFDUSHWH[WUDFWRUZDQG$WWDFKHVWR1HSWXQH+DUGWR UHDFKFDUSHWDUHDV êî 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO (48,30(173/$1 473 *DOORQDORQJZLWK&DGG\%DJ 0RGHO+ 'ROO\0RGHO+ *DOORQ%UXWHZLWK&DGG\%DJLGHDOIRUWUDVKDQGUHF\FOHVRU QJ$V ZHOODVDFFRPLGD QJFOHDQLQJWRROV%UXWHZLWKZKHHODVVHPEO\ 5XEEHUPDLG7([HFXWLYH+LJK6HFXULW\+RXVHNHHSLQJ &DUW5HFRPPHQGHGXQGHU*RYHUQPHQW)XUQLVKHG3URSHUW\ dsÂ«Ę8s«Ę±¾ĘI±¾Ès~¤ĘdsÂ«Ę8s« :DVKHU'U\HUWRODXQGU\DOOUDJVPRSVDQGZDVKDEOH FOHDQLQJVXSSO\6LPLODUDOWHUQDYHVDYDLODEOH3OHDVHDVNXV IRURSRQV 1%91;3UR&RPPHUFLDO&RUGOHVV&OHDQLQJ %DWWHU\DQGFRUGIUHHWRDYRLGWULSKD]DUG$OOYDFXXPVDUH/((' FHUWLILHGDQG(&2IULHQGO\RSWLRQV1XPDWLFZLWKKXVKWRQHIRUGD\WLPH RIILFHFOHDQLQJDQGIORRUZDQGWRFOHDQFDUSHWVDQGKDUGIORRUV1XPDWLF LVRQHRIWKHPRVWGXUDEOHYDFXXPVLQWKHPDUNHWZLWKD\HDUZDUUDQW\ 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO (48,30(173/$1 474 )LOWHUV IRU +HQU\ 1%91; EDWHU\ YDFXXP )LOWHUVIRU+HQU\1%91;EDWHU\YDFXXP +<*(148,&.&211(&7)5$0(<(//2:6.8 )*4</7REHXVHGZLWK0LFURILEHU.LWIURP5XEEHUPDLG HYGEN™ 11" MICROFIBER WET PAD, BLUE. SKU: FGQ82000BL00 To be used with Microfiber kit from Rubbermaid. 7HQQDQW7)ORRU6FUXEEHURU1LOILVN 7HQQDQW7'LVN)ORRU6FUXEEHU'HPR)ORRU6FUXEEHU'LVN)ORRU 6FUXEEHURIIHUVWKHRSHUDWRUWKHFKRLFHRIXVLQJSDGKROGHUVRUEUXVKHV 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO (48,30(173/$1 475 9DULDEOH6SHHG)ORRU0DFKLQH 6ROXWLRQIRUKDUGIORRUVFUXEELQJDQGIRUKHDY\GXW\FOHDQLQJ 5XEEHUPDLG/REE\%URRPDQG'XVW3DQ 4XDQWLW\ 5XEEHUPDLG0LFURILEHU0RS 4XDQWLW\8QOLPLWHG 0LFUREHU0RSV 5XEEHUPDLG0RSH:ULQJHU%ODFNLIDYDLODEOH :LWK5HPRYDEOH*UD\'LUW\:DWHU%XFNHW 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO (48,30(173/$1 476 9LSHU&DUSHW6SRWWHU v 36,SXPSRIZDWHUOLIW v &RPHVZ KRVH FDUSHWJURRPLQJ WRRO v JDOORQVROXWLRQJDOORQUHFRYHU\ v :HLJKVOEV 6WHDPFOHDQHU PD\EHREWDLQHGIRUNLWFKHQLIQHHGHG 3UHVVXUHZDVKHU *DOORQVSHUPLQXWH RURWKHUORFDOO\NQRZQEUDQG %DWWHU\DLUEORZHUV /LWKLXP,RQ%DWWHULHV 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO (48,30(173/$1 477 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 89 89UĘIIL? $ +06IROORZVDK\EULGPDQDJHPHQWDSSURDFKZLWKWKHSULPDU\REMHFWLYHRISURYLGLQJDEHVWLQFODVV FXVWRPHUH[SHULHQFH v :HUHFHLYHFRQVWDQWUHDOWLPHIHHGEDFNIURPDOOVWDNHKROGHUVHPSOR\HHVFOLHQWVYLVLWRUV YHQGRUVHWFDQGXVHWKDWIHHGEDFNWRLPSURYHSURFHVVHVDQGZRUNIORZV v :HEHOLHYHWKDWDOOVWDNHKROGHUVKDYHDQLPSRUWDQWYRLFHLQFROOHFWLYHO\ZRUNLQJWRLPSURYHRXU RSHUDWLRQVDQGXOWLPDWHO\FOLHQWVDWLVIDFWLRQ v +06 V([HFXWLYH0DQDJHPHQW7HDPFROOHFWVGDWDDQGFRQVWDQWO\VHWV DVSLUDWLRQDOJRDOVWREHWWHUVHUYLFHRXUFOLHQWV v :HDUHFRQVWDQWO\HYDOXDWLQJRSSRUWXQLWLHVWRLPSURYHWKHFOLHQWH[SHULHQFHDQGVKDUHNH\ µHQDEOHUV¶WRGULYHWUDQVIRUPDWLRQDOFKDQJH v 2XUREMHFWLYHLVWRFRQVWDQWO\LPSURYHWKHFOLHQWSDWLHQWH[SHULHQFHZLWKDSULPDU\IRFXVRQ 2SHUDWLRQDO([FHOOHQFH 478 The three building blocks of customer-experience transformations. Build aspiration and purpose Enable the transformation Transform mind-sets and build capabilities Step up technology,data,and analytics Establish cross-functional governance and agile operating model Deploy measurement and performance¬ management system Develop customer-centric vision and aspiration Establish link to value Translate into roadmap Transform the business Discover customer needs Design solutions Deliver impact Journeys Products Services Business models 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO IIL? $ĘU?Ę ZPU?8LĘPU&P U&?9 2XUDSSURDFKDQGZRUNIRUFHWUDLQLQJFRQVLVWRIDXQLTXH PRGHOWKDWWKLQNVDKHDGWRGHOLYHUFXVWRPHUH[SHFWDWLRQV ZLWKRXWWKHFXVWRPHUDVNLQJ 5DWHXVVWDUVPDQDJHPHQWDSSURDFK +HUHLVKRZ Quality Control &RQWLQXRXVVXSHUYLVLRQE\GLIIHUHQWVXSHUYLVRUVZKRFROODERUDWHRQ FRQVWUXFWLYHIHHGEDFNDQGIRVWHULQJSURIHVVLRQDOGHYHORSPHQWDUH LPSRUWDQWWRDOOVWDNHKROGHUVXFFHVVDQGFOLHQWVDWLVIDFWLRQ Training, Accountability and Safety $QLQWHJUDWHGDQGFRPSOHWHSODQH[HFXWHGGDLO\ Business is human, processes and technology :HUHYLHZRXUSURFHVVHVDQGSHRSOHGDLO\(UURUVDUH KXPDQ7RXVLW VWKHHIILFLHQF\RIWKHSURFHVVLQYROYHG WRUHVROYHLW$FKLHYLQJRSHUDWLRQDOHIILFLHQF\ HMS Ownership Involvement and Management Reporting 2ZQHUVKLSLVHQJDJHGLQWKHFRQWUDFWDFWLYLWLHVDQGUHYLHZV PDQDJHPHQWDQGFOLHQWWHDPUHSRUWLQJ Quality of Service Results and Accountability ([FHHGLQJH[SHFWDWLRQVDQGSHUIRUPDQFHUHTXLUHPHQWV (DFKWHDPPHPEHULVKHOGDFFRXQWDEOHWRHQVXUHRXUWHDPFOHDUO\ XQGHUVWDQGVWKHLUUROH 479 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 0jĘIL?L89 Ę&9& U?LP .3, VDUHDQHVVHQWLDOSDUWRIRQERDUGLQJLQJRYHUQPHQW FRQWUDFWV:HZLOOZRUNZLWKWKHJRYHUQPHQW&25WRHVWDEOLVK .3, VWRPHDVXUHWKHSHUIRUPDQFHRIWKHFRQWUDFW 4XDOLW\RI6HUYLFHE\PDLQWDLQLQJDFFHSWDEOHOHYHOVWKURXJK 4XDOLW\&RQWURO &OLHQW6DWLVIDFWLRQDQGUHVSRQVLYHQHVV0HDVXULQJQXPEHU RIFRPSOLPHQWVQXPEHURIFRPSODLQWVDQGQXPEHURI VSHFLDOUHTXHVWVXEPLWWHGYHUVXVFRPSOHWHG -DQLWRULDO:RUNHUVDUHPHDVXUHGE\DVVHVVLQJWXUQRYHU UHWHQWLRQDEVHQWHHLVPDQGSURGXFWLYLW\ 6DIHW\+HDOWKDQG6XVWDLQDELOLW\PHDVXUHVQHDUPLVVHVRI LQFLGHQWVIORRUVOLSWHVWLQJIULFWLRQDQGGXVWOHYHOLQWKH XVLQJXVLQJSDUWLFOHWHVWLQJ )LQDQFLDOHYDOXDWHVWKHRYHUDOOFRVWRIFOHDQLQJE\DFKLHYLQJ SHUIRUPDQFHDQGVWD\LQJZLWKLQFXVWRPHUEXGJHW 480 KPIs Use Measure performance Align strategy with actions Facilitate decision Motivate employees A Identify des opportunities Risks Inappropriate indicators =Misunderstanding 245 Too many indicators =Distraction Manipulation =Misalignment @ Pressure by KPIs=Stress /Dissatisfaction KPi 'sX Only figures =Lack of the non-measurable 34 Identify Transition Team Expectations Meeting On Site Orientation Order Equipment Supplies Employee Screening Hiring Employee Training Set-Up Web-based Quality Control Inspection System Deﬁne Invoicing Proccess Service Start-Up Follow-Up Meeting Transition Plan Discuss staff performance with Client´s Management Team Obtain seniority list Conduct talent assessments Interview Incumbent staff Initiate training Retain Incumbent Staff [When requested by client] 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 481 Combined 60 years of experience Commercial, Government Medical Bdlg. Experience Trained in all aspects of Orange QC Trained in BBP, Hazmat Communications, Terminal Cleaning Continuous education on industry best practices KÍs¤ÈÝĘ ±«È¾±¤Ę&«Â»È±¾Â 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 482 Reports are web-based with GPS veriﬁcation time stamped “Below Average” scores trigger real-time alert Automatically generates reports for customers QUALITY CONTROL IS INFECTION CONTROL QC Technology Our QC ofﬁcers test surfaces to validate cleaning effectiveness creating a safer environment for all visitors and employees HMS has dedicated Quality Control Ofﬁcers that conduct unannounced on-demand inspections. Our Orange QC program allows us to monitor the quality of our service in real-time. WE PROVE QUALITY KÍs¤ÈÝĘ ±«È¾±¤ĘI¾±ÂÂĘ?Ö¾Ö× 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 483 Client sends email to ʻ˘˥ˠˢ˦˜˟˟ˢ@highmaintenanceservices.com Email triggers ticket alert to HMS assigned team Contract Manager Janitorial General Manager Janitorial Assistant General Manager HMS´s C.E.O. Ticket remains open sending continuous alerts until corrected by Contract Manager Client Ticket System Communication to client on issue resolution is made LÂ»±«ÂĘÈ±Ęª¾«ÈĘ¤s««Ę±«¾«Â 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 484 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO ?LL U&cĘ U&?9ĘIL? PP 3UREOHP 6WXG\FDXVHRISUREOHPDQGHYDOXDWH ,QWHUYHQHDQGSUHSDUHUHVROYH +ROGUHVSRQVLEOHSDUWLHVDFFRXQWDEOH 7UDLQVWDIIRQVROXWLRQ (VWDEOLVKH[SHFWDWLRQVDQGFRPSOHWLRQRIUHVROYH 'RFXPHQWOHVVRQVOHDUQHG ,QIRUPPDQDJHPHQWDQGFOLHQWDSSURYDO )ROORZLQJDVLPSOLILHG'0RGHO+06 GHYHORSHGD&$5SURFHVVHV >&RUUHFWLYH$FWLRQ5HTXHVW@ 485 *NQMFNFOUBUJPOBOE5SBOTJUJPO5BTL'PSDF $POUSBDU-FBE$0310$ 3PMF -JBTPOCFUXFFOClient BOE).4 *NQMFNFOUBUJPO &NQMPZFF0SJFOUBUJPO &RVJQNFOUBOETVQQMZPSEFST PGGTJUFUSBJOJOHDPPSEJOBUJPO TFSWJDFEFMJWFSZ "GUFSJNQMFNFOUBUJPO2VBMJUZ$POUSPM $MJFOU FYQFDUBUJPOTDPPSEJOBUPS NFFUJOHT BOEDVTUPNFS SFMBUJPOTIJQNBOBHFS 4VQFSWJTPST POTJUF 3PMF3FTQPOTJCMFGPSEBZUPEBZPQFSBUJPOTBOEBDUBT MJBTPOTCFUXFFO).4BOE$0310$ 2VBMJUZ$POUSPM.BOBHFS POTJUF 3PMF7FSJGZRVBMJUZDPOUSPMPGTVQFSWJTPST 5FBN)FBMUI.POJUPS 3PMF5SBJOFEGPSPDDVQBUJPOBMIFBMUIBOEWFSJGJDBUJPOPG IPTUDPVOUSZXPSLTBGFUZDPNQMJBODF )34QFDJBMJTU 3PMF"MMBTQFDUTPGMFHBMBOEMBCPSMBX%SBGU DPOUSBDUTBOEFOTVSFDPNQMJBODF Implementation Task Force 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 486 Implementation and Transition Task Force Implementation Task Force 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO Intentionally left blank 487 5PCFXJUIJOEFMJWFSBCMFTTDIFEVMF XFXJMMDPPSEJOBUFUIF GPMMPXJOH v $PNNVOJDBUJPODIBOOFMTBOEDPOUBDU FYBNQMF$03 v 6OJGPSNSFRVJSFNFOUT v &RVJQNFOUSFRVJSFNFOUTBOEQSPDFTTPSEFST v *EFOUJGZJOEJWJEVBMTBOESFTQPOTBCJMJUJFT DIBJOPG DPNNBOE v %FWFMPQJOTQFDUJPOSFQPSUQFS$03FTUBCMJTIJOH QFSGPSNBODFNFBTVSFTBOEDSJUFSJB v *EFOUJGZFBDIEFQBSUNFOUTQFDJGJDOFFEBOESFRVJSFNFOU JFTDIFEVMFPGDMFBOJOHBVOJU v *EFOUJGZTUPSBHFBSFBBOETFUVQXPSLEFTL ).4 QVSDIBTFE JGQPTTJCMF v %BUFPGTJUFUPVSXJUIUFBN v *EFOUJGZQPUFOUJBMDPOUSBDUVBMHBQT v #JMMJOHQSPDFTT Expectations Meeting 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 488 To be within deliverables schedule,we will coordinate the following: o Communication channels and contact (example COR). o Uniform requirements. o Equipment requirements and process orders. o Identify individuals and responsabilities (chain of command). o Develop inspection report per COR establishing performance measures and criteria. o Identify each department specific need and requirement, (ie.schedule of cleaning a unit). o Identify storage area and set up work desk (HMS purchased)if possible. o Date of site tour with team. o Identify potential contractual gaps. o Billing process. v 6OJGPSNT v $IFNJDBMT v %VTU1BOT v 'MPPS$BSF.BDIJOFT v 7BDVVNT v $BSQFU'BOT v #SVUF#BSSFMT v %JTJOGFDUJPOFRVJQNFOU 5#% v )BOE4PBQ v 3VCCFS(MPWFT v (FSNJDJEFDIFNJDBMTBOEXJQFT v 4BGFUZ&RVJQNFOU XFUGMPPSTJHOT 11& FUD v .JDSPGJCFSXFUNPQTBOEEVTUNPQT v .JDSPGJCFSSBHT v 8FU7BDVVNT v #BDLQBDLPSCBUUFSZWBDVVNT v $BSQFUTQPUDMFBOJOHNBDIJOF v #SVUFIPQQFST v &ZF1SPUFDUJPO v 1BQFSQSPEVDUT v 4DSVCQBETGPSGMPPSNBDIJOFT v .PQCVDLFUTXJUIHSBZXBUFSIPMEFS Contractor Furnished Materials 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 489 o Uniforms o Chemicals o Dust Pans o Floor Care Machines o Vacuums o Carpet Fans o Brute Barrels o Disinfection equipment (TBD) o Hand Soap o Rubber Gloves o Germicide chemicals and wipes o Safety Equipment (wet floor signs,PPE,etc.) o Microfiber wet mops and dust mops o Microfiber rags o Wet Vacuums o Backpack or battery vacuums o Carpet spot cleaning machine o Brute hoppers o Eye Protection o Paper products o Scrub pads for floor machines o Mop buckets with gray water holder. Contractor Furnished Materials 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO Bathroom gel hand soap for dispensers Bathroom paper hand towels Bathroom toilet paper All-purpose cleaner General degreaser General disinfectant Graffiti remover Carpet cleaner Solvent spotter Gum remover Bathroom deodorizers Urinal deodorizers Lime and scale remover Toilet bowl cleaners Disinfectant wipes for the gym equipment Tile cleaner – liquid or gel Glass/window cleaner – liquid (must comply with FEBR recommendations) Brooms – both standard and heavy duty Mops – heavy duty Wringers Squeegees Brushes Scouring pads Wiping rags – microfiber* Dust remover Plastic trash bags (various sizes). All must be heavy duty to minimize breakages. At least 2 carts with wheels (i.e. dolly or similar) to move material/supplies around. Rubber hand gloves – cleaning Buckets – with mop squeezer 490 ª»¤±Ýª«ÈĘÂ¾««Ęs«Ę¾½ÍÂÈÂĘ $8PĘª»¤±Ýª«ÈĘL½ÍÂÈÂ ?& ĘZPĘ?92j ª»¤±Ýª«ÈĘs«Ę¾«Ę»¾±ÂÂĘö v $¾Ę¾±ªĘ¢«±×«Ęs«ĘÈ¾ÍÂÈĘÂ±Í¾ÂĘ~±¾ĘsÖ¾ÈÂ«ü v êĘ»s«¤Ę«È¾Ö×Âü v s¢¾±Í«Ę¢Ęs«Ę«ÖÂÈsÈ±«Ęĉ«±Ę¾ª«s¤ĘÂÈ±¾Ý allowedĊĘ±ªÂÈĘs« «È¾«sÈ±«s¤ü v ¾ÍĘ¾Ęd±¾¢»¤sĘĉ¾ÍĘÂ¾««ĘsÈĘ¾s«±ª÷ĘĘs¤¤±×Ę~ÝĘ¤±s¤Ę¤s×Ċü 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 491 This iorm muit Ibe completely filed. DT-ER HEW HIRE _RE-HIRE Zl TRANSFER Employee Bfeme:DNo.:Effective Det? Position:Hates Location: PREREQUISITES:(CHECK OFF ALL REQUIRED PEA POSITION) LEVEL 2 BG 7 YRS BIDHAZARD WASTE HANDLING Zl DRUG TEST Zl PPL USE BLODCBD1NE PATFCGEK “RAININ 5 1 CLEAN CHECK TRAINING Zl TERM NAL CLEANING IOR|TRAINING Zl INCIDENT REPORTING Zl HIGH DISINFECT ON TRAININS Zl CUSTOMER SERVICE TRA INI MG Zl SUP AND FALL PREVENTION Zl FLU SHOT Zl IE SHOT Zl HI PPA TRAINING GIVEN GIVEN EMPLOYEE ID TES N/A PHONE AND/OR RADIO res K/A PAYDOM ACCESS ZES Zl N/A SUNPASS Z res Zl N/A UNIFORMS res N/A SAS CARD res H/a KEYS ?ES Zl N/A FOE IZ YES Zl H/A LAPTOP res Zl N/A PHONE AND/OR RACK)Z res Zl N/A IManager/Sipmfsor .Slgnauii e.Da te: HR Representative:Sisnature:Date:_ =Verify Preventing slips, trips falls Accident reporting Lost found policy Bloodborne pathogens Personal Protective Equipment training SDC/Chemical safety U¾s««Ę?Ö¾Ö× 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 492 SDS CHEMICAL SAFETY AND MANAGEMENT OSHA COMPLIANT OCCUPATIONAL HEALTH WORK LIFE BALANCE AND MENTAL HEALTH SERVICE TRAINING EQUIPMENT USE TRAINING CHEMICAL APPLICATION TRAINING MICROFIBER COLOR CODED CLEANING TRAINING WORKPLACE ACCIDENT PREVENTION DRUG FREE WORKPLACE POLICY ACCIDENT REPORTING, MANAGEMENT AND CARE OPTIONS LOST AND FOUND POLICY CELL PHONE POLICY BLOODBORNE PATHOGENS PERSONAL PROTECTIVE EQUIPMENT MANAGEMENT 7UDLQLQJ3ODQ 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 493 FIRST AID AND CPR OSHA HAZCOM ETIQUETTE TRAINING CONFLICTS OF INTEREST CUSTOMER SERVICE TRAINING TERRORIST, NATURAL DISASTERS AND EMERGENCY RESPONSE EMERGENCY PROCEDURES SEXUAL AND UNLAWFUL HARRASSMENT WORKPLACE VIOLENCE PREVENTION RECYCLING PROGRAMS HIPPA SECURITY MANDATED PROTOCOLOS GENERAL ORIENTATION CUSTOMER POLICY TRAINING OSHA HIPPA HAZCOM 7UDLQLQJ3ODQ 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 494 dĘ¾s¤âĘÈĘª»±¾Ès«ĘÈsÈĘsĘ»¾±»¾¤ÝĘ«ÈæĘª»¤±ÝĘs«ĘsÖ ×±¾¢«Ę«ĘsĘ±Ö¾«ª«ÈĘ~Í¤«üĘ ±¾ĘÈÂĘ¾sÂ±«÷Ę$8PĘ»¾±ÖÂĘÍ«±¾ªÂĘÈsÈĘs¾ĘsÂ¤ÝĘ«Èæs~¤Ęs«Ę »¾±ÂÂ±«s¤üĘ /s«È±¾s¤Ęª»¤±ÝÂĘ×s¾Ę~¤s¢Ę±¤±¾Ę»±¤±čÂ¾ÈÂĘ×ÈĘ±ÍÈĘ¤±±Ę¤s¾¤ÝĘÖÂ~¤üĘ P¾ÈÂĘs¾ĘªsĘ±ĘsĘ»±¤ÝÂÈ¾č±ÈÈ±«Ę~¤«ĘÈsÈĘªs¢ÂĘÈĘsÂÝĘ±¾Ę±Í¾Ę¤s««ĘÂÈsĘ È±Ę¢»ĘÈªĘ¤s«üĘdĘÂÂÍĘÈ¾ĘÂÈÂĘÈ±ĘsĘª»¤±ÝĘs«Ęª«Ę±¾Ę¾»¤sĘ ÈªĘsÂĘ«ü ÈĘ¤«ÈĘ¾½ÍÂÈĘ÷Ę×Ęs«ĘÍÂÈ±ªâĘÍ«±¾ªÂĘÈ±ĘªsÈĘ¤«ÈĘ±ª»s«ÝĘÈªüĘĘ UĘ«ÈæsÈ±«Ęs¾ĘÂĘ¡ÍÂÈĘsÂĘª»±¾Ès«ÈĘsÂĘsĘ¤s¾Ę«Èæs~¤ Í«±¾ªüĘÖ¾ÝĘ$8PĘª»¤±ÝĘÂĘ»¾±ÖĘs«Ęª»¤±ÝĘ&Ęs«Ę ¾½Í¾ĘÈ±Ęs¾¾ÝĘÈĘ×ÈĘÈªĘÍ¾«Ę×±¾¢Ę±Í¾Âü $8PĘÍ«¾ÂÈs«ÂĘs«Ę«±¾ÂĘÈĘ«ĘÈ±ĘsÖĘs¤¤Ę»¾Â±««¤Ę ¤s¾¤ÝĘ«ÈæüĘdĘ×s«ÈĘÈ±Ęªs¢ĘÂÍ¾ĘÝ±Í¾ĘÂÈsĘs«ĘÖÂÈ±¾ÂĘ¤ĘÂsĘs«ĘÈsÈĘ ÈÝĘs¤×sÝÂĘ¢«±×Ę×±ĘÂĘ×±¾¢«Ęs¾±Í«ĘÈªü v $8PĘ»¾±ÖÂĘÍ«±¾ªÂĘÈsÈĘs¾ĘsÂ¤ÝĘ«Èæs~¤ĘķĘ»¾±ÂÂ±«s¤ü v UĘ$8PĘ¤±±Ę×¤¤Ę~ĘÂÈÈĘ±«Ę~ÍÈÈ±«ĘÂ¾Èü v U¾ĘÂÈÂĘs¾ĘÂÂÍĘÈ±ĘsĘÈsªª~¾Ęs«Ęª±¾ĘsÂĘ«ü Employee Identification & Uniforms 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 495 JUAN PEREZ Operations Manager Sanitation Services jrxiuio k--%ژGژȽǠȄƩƷژא׎׏ב ¾¨Å-ژî-¨ژÞƌȽɋƷژưɫǠȽȏȵژȽǠȄƩƷژא׎א׎ Å°ژGȵƷƷȄژɓǠǹưǠȄǒژȏɓȄƩǠǹژuƌȵǵƷɋ kƷƌưƷȵيژ Å°GژÞȏȂƷȄژǠȄژGȵƷƷȄژFǹȏȵǠưƌژ٢ȏٮ ǚƌǠȵ٣ ÞǠȄȄƷȵژȏǑژÅ°GژFǹȏȵǠưƌژÝȏǹɓȄɋƷƷȵ ȏǑژɋǚƷژɲƷƌȵ ¾ȵǠٮǹǠȄǒɓƌǹژ٢-ȄǒǹǠȽǚًژ°ȲƌȄǠȽǚژۯژȽȏȂƷ UɋƌǹǠƌȄ٣ ٫°٫ڳǒȵǠƩɓǹɋɓȵƌǹڳȏȂȂɓȄǠƩƌɋǠȏȄڳƌȄư kƷƌưƷȵȽǚǠȲڳ%ƷɫƷǹȏȲȂƷȄɋڳچڳFȏƩɓȽڳȏȄڳɋǚƷ ƷȄɫǠȵȏȄȂƷȄɋڳ ڳǑǹɓƷȄɋ ڳǑǹɓƷȄɋڳ ڳUȄɋƷȵȂǠưǠƌɋƷ k w G Å G - ° Ý - ¨ Ý U - Þ - ¨ ¾ U F U ¾ U w ° ٖ Þ ¨ % ° ِژO ژU ژ- ژFژ ° ژÅ ژ° ژ¾ ژ ژU ژw ژ ژ ژU ژk ژU ژ¾ ژä ژF ژF ژU ژ ژ- ژ¨ ƌȵƨƌȵƌژGƌȵƩǠƌ - ژ% ژÅ ژ ژ ژ¾ ژU ژ ژw ÅȄǠɫƷȵȽǠɋɲژȏǑژFǹȏȵǠưƌژGȵƌưɓƌɋƷژ 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO PÍÂÈs«s~¤ÈÝĘ?¾ 496 !""#$%& &’(")$%& (%$%*+#!,- $!,"%(%,$% '$,/<6(59,&(6 '$,/<)/225 0$,17(1$1&( %.%/)+!(& &+)#(0%..&- 1(%)2(!!3 -.’,$4-(!!3 - .!’,5% 2#+$4%,%++%&'$,/<6(59,&(6 /67889-:-;<9=><-?<@;AB-6C?-9=D-EF==;-GAD<- ?=GC-ACH<;A=;-6C?-<IH<;A=;-J<67K-EF==;L-=E-76@- AC7F8?ACM-H;67N-7=;;A?=;- O (<9=><-6CP-BH6ACB-6C?-EACM<;D;ACHB O .<6><-C6H8;6F-BKAC< O QABACE<7H-@8HH=CB O )FF-H;6BK-;<7<DH67F<B-6;<-H=-@<-<9DHA<?-6C? H;6BK-;<9=><?-H=-6-7=FF<7HA=C-D=ACHR O Q8BH-9=D-K6;?-B8;E67<-EF==;B-H=-;<9=>< BDAFF6M<-E;=9-B=AF<?-6;<6BR O $F<6C-6C?-GAD<-H6@F<B-6C?-7K6A;B O &D=H-7F<6C-G6FFB-C<6;-H;6BK-;<7<DH67F<B O $F<6C-6C?-?<BACE<7H-9A;;=;B O $F<6C-B6CAH6;P-C6DNACM-;<7<DH67F<B-6C?-GAD< GAHK-6-?<BACE<7H6CHR O +=AF<HB-6C?-8;AC6FB-H=-@<-7F<6C<?-6C?B6CAHAS<? ACBA?<-6C?-=8HBA?<R-*=FABK-@AMKH-G=;NR O +=AF<H-B<6HB-H=-@<-7F<6C<?-=C-@=HK-BA?<B-8BACM 6-?<BACE<7H6CHR O Q<BACE<7H-KAMK-H=87K-D6;HAHA=CBT-?==;BT-6C? H=D-=E-9A;;=;B-6C?-E;69<BR O 3=D-6C?-;ACB<-;<BH;==9-EF==;B-GAHK-6 ?<BACE<7H6CH O /67889-76;D<H<?-6C?-C=CU76;D<H<?-6;<6B AC7F8?ACM-7=;C<;B-6C?-<?M<BT O (<9=><-6FF-D6D<;7FADB-BH6DF<B-6C?-=HK<; ?<@;AB-E;=9-6;=8C?-?<BNBT-H6@F<BT-7;<?<CS6BT ?ABDF6P-8CAHBT-EAFFACM-76@AC<HBR O Q8BH-9=D-6FF-K6;?-B8;E67<-EF==;-6;<6BR-0<H 9=D-6FF-K6;?-B8;E67<-EF==;-6;<6BR-&G<<D-6C?- G<H-9=D-BH6A;BR O %9DHP-6FF-H;6BK-;<7<DH67F<B-6C?-;<DF67<-FAC<;B 6B-C<<?<?R-(<9=><-H;6BK-H=-6-7=FF<7HA=C-D=ACHR O /67889-76;D<HACMR O $F<6CT-?<BACE<7HT-D=FABK-?;ACNACM-E=8CH6AC-: G6H<;-7==F<;R O Q<BACE<7H-6FF-K=;AS=CH6F-B8;E67<BT-AC7F8?ACM ?<BNH=DBT-EAF<BT-GAC?=GBAFFBT-7K6A;BT-H6@F<BT-6C? DA7H8;<BR O Q69D-GAD<-6FF-K=;AS=CH6F-B8;E67<B-H=-;<9=>< 7=EE<<-;ACMB-6C?-BDAFF6M<R O Q8BH-6C?-?<BACE<7H-H<F<DKK=C<B O Q8BH-9=D-K6;?-B8;E67<-EF==;B-GAHK-6-H;<6H<? ?8BH-9=DR O Q69D-GAD<-<CH<;G6P-6C?-7F<6C-EACM<;D;ACHB E;=9-<CH;6C7<-MF6BBR O &D=H-7F<6C-D6;HAHA=C-MF6BBR O #CBD<7H-6C?-DA7N-8DT-6B-C<<?<?T-@8AF?ACM <CH;6C7<-6;<6R &G<<D-6C?-;<9=><-?<@;AB 7F<6C-6C?-?ABACE<7H-?==;B-6C?-K6C?F<B '$,/< 5(675220 6(59,&( $5($7$6.2%-(&7,9(5(48,5(0(17 1.3.1.2 Dusting and cleaning all furniture including desks, chairs, credenzas, computer tables, telephone tables, bookshelves with or without glass doors, coat racks, umbrella stands, pictures, maps, telephones, computers and CRT screens, lamps and other common things found in an office environment. All furniture shall be free of dust, dirt, and sticky surfaces and areas. 1.3.1.5 Waste Management - adhere to Embassys Zero Waste Program, where handling of waste includes but not limited to: proper placement of waste in pre-determined waste containers, capturing of waste in pre-identified bag, weighing of waste in provided scale, recording of weight. Zero Waste Program documentation will be provided after the award.\ 1.3.1.5.1 Following the ZERO waste Program, Emptying all wastepaper baskets, ashtrays and washing or wiping them clean with a damp cloth, replacing plastic wastepaper basket linings and returning items where they were located. 1.3.1.5.2 Removing trash to designated area as directed by the COR, and keeping trash area in a reasonably clean condition. 1.3.1.7 Removing any grease marks or fingerprints from walls, doors, door frames, radiators, windows and window frames, glass desk protectors, reception booths and partitions. 1.3.1.6 Cleaning of glasses, cups, and coffee services in conference facilities and in the Ambassador’s office area. The Contractor shall clean the items in hot soapy water and rinse, dry and polish so that a presentable appearance is maintained. 1.3.1.9 Cleaning the HU and gym areas 1.3.1.4 Thorough cleaning of toilets, bathrooms, mirrors, and shower facilities, using suitable non-abrasive cleaners and disinfectants. All surfaces shall be free of grime, soap scum, mold, and smudges. The Contractor shall refill paper towels, toilet paper, and soap in all bathrooms. The Contractor shall check those areas used by personnel visiting the chancery several times daily to ensure that the facilities are always clean and neat. 1.3.1.1 Sweeping all floor areas including damp mopping of areas such as tile, linoleum, travertine, limestonefloors (see attachment 4), staircases, roof and public areas (parking lots and sidewalks). Floors shall be free of dust, mud, sand, footprints, liquid spills, and other debris. Chairs, trash receptacles, and easily moveable items shall be tilted or moved to clean underneath. The frequency may be higher than once per day when it is rainy. When completed, the floor and halls shall have a uniform appearance with no streaks, smears, swirl marks, detergent residue, or any evidence of remaining dirt or standing water. 1.3.1.3 Vacuuming all clean rugs and carpets, runners, and carpet protectors so that they are free from dust, dirt, mud, etc. When completed, the area shall be free of all litter, lint, loose soil and debris. Any chairs, trash receptacles, and easily moveable items shall be moved to vacuum underneath, and then replaced in the original position. 1.3.1.8 Sweeping debris from walkways and driveways and hose cleaning them during appropriate climatic and water use conditions. Cleaning elevators and emergency exits. Cleaning elevators and emergency exits.SAMPLE ONLY WILL BE MODIFIED PER RFP REQUIREMENTS 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO WILL INCORPORTATE TASKS AND FREQUENCIES PER PERFORMANCE WORK STATEMENT 497 !""#$%&’()*$%*+,)’-.*,/’+(), *+,)’-.*,.$"0(+(1,.*".#$+2)10)*"3+(1,/$0."2"()30(."24$’55%4.’&&’(,03"022-//$%,4,60(+)’3+0$.$’2")/3"7"().3’22,.’()0&+(0)+’(8 .9:;<,;<=,=>?><@:AB,?CD@;A:?8 &EF,@9EED?,G>BH,@9EED,A9:;<:D8 /:D@EDI,=C?B><J,E<,HED>KE<B;9,?CD@;A:?8 /:D@EDI,=C?B><J,E<,L:DB>A;9,?CD@;A:?8 )D;?H,D:IEL;9,;<=,D:F9;A:,A;<,9><:D8 .9:;<,J9;??8 2G::F,@9EED?8 7;ACCI,A;DF:B?8 MC?B,N;?:NE;D=?8 /:D@EDI,H>JH,=C?B><J!""#$%,.$"0(+(1,’OO+."2P,$’55%P,$-(.*3’’&P,.’(O"3"(.",3’’&8 MC?B,;99,L:DB>A;9,?CD@;A:?,E@,=:?Q?P,@>9:A;N><:B?P,AH;>D?P,B;N9:?,;<=,EBH:D,E@@>A:@CD<>BCD:8 )HEDECJH9R,L;ACCI,;99,A;DF:B><JP,B;Q><J,A;D:BE,J:B,><BE,AED<:D?P,;9E<J,:=J:?,;<=,N:<:BH@CD<>BCD:S8 M;IF,IEF,H;D=,?CD@;A:,@9EED?P,B;Q><J,A;D:,BEJ:B,><BE,AED<:D?P,;9E<J,:=J:?,;<=,N:<:BH@CD<>BCD:8 .9:;<,><B:D>ED,E@,D:@D>J:D;BED,4,)E??,E9=,@EE=S8 +<L:<BEDR,I;<;J:I:<B8 .9:;<,?><Q8 ’DJ;<>K:,?CFF9>:?8 3:T?BEAQ,?CFF9>:?8 2G::F,;<=,IEF,@9EED?S8 2G::F,@9EED?8 7;ACCI,A;DF:B?8 MC?B,N;?:NE;D=?8 /:D@EDI,H>JH,=C?B><J8 .EIF9:B:,;99,H>JH,=C?B><J,<EB,D:;AH:=,><,BH:;NEL:TI:<B>E<:=,A9:;<><J8 7;ACCI,;99,C<FHE9?B:D:=,@CD<>BCD:8 3:IEL:,AENG:N?8 MC?B,N9><=?,;<=,G><=EG,?H;=:?8 .9:;<,N9><=?,;<=,G><=EG,?H;=:?*>JH,BECAH,>B:I?,;D:,;IE<J,BH:,IE?B,F;BHEJ:<,H:;LR,?CD@;A:?,><,RECD,@;A>9>BRP3ECB><:,A9:;<><J,;<=,=:?><@:AB><J,E@,BH:?:,>B:I?,;9E<J,G>BH,@D:UC:<B,H;<=,G;?H><J,;D:,AD>B>A;9,BE,ND:;Q><J,BH:,AH;><,E@,><@:AB>E<,;<=,AD:;B><J,A9:;<P,?;@:,;<=,H:;9BHR,:<L>DEI:<B?.H;>D,H;<=9:?,V,5;AQ?.E@@::,I;AH><:?,V,FEB?.EC<B:D,BEF?M:?QBEF?MEED,J9;??MEED,H;<=9:?,V,:=J:?"9:L;BED,NCBBE<?,V,=EED?"IF9ER::,A:99,FHE<:?#>E?Q,NCBBE<?#:RNE;D=?,V,&>A:$>JHB,2G>BAH:?&;>9NEW:?&>ADEG;L:?5D:;Q,DEEI,;D:;?,X0F9>;<A:?P,?><Q?P,AH;>D?,V,B;N9:?Y3:?BDEEI?,XD:?BDEEI,@9C?H,H;<=9:?P,BE>9:B,=>?F:<?:D?Y,.E<@:D:<A:,DEEI,B;N9:?,V,AH;>D?’F:<,?H;D:=,GEDQ?F;A:?.’7+M3"2/’(2",0(M1-+M"$+(".’&/$+0(."8 0NC<=;<B,?BEAQ,E@,@D:?H,I>ADE@>N:D,A9EBH?8 .E9ED,AE=:=,I>ADE@>N:D,?R?B:I8 ’<T?>B:,4,’@@T?>B:,9;C<=DR$5($7$6.2%-(&7,9(5(48,5(0(17/HE<:?/E=>CI?/D><B:D,4,O;W3:@D>J:D;BED,H;<=9:?,;<=,=EED?2><Q,@;CA:B:?,V,H;<=9:?2B;>D,D;>9?2B;F9:D?,V,?B;F9:,D:IEL:D?);N9:BEF?);F:,=>?F:<?:D?)>I:,A9EAQ?)E;?B:D,’L:<?)D;?H,D:A:FB;A9:?7:<=><J,&;AH><:?!;B:D,@EC<B;><?1.1.3.1.8 Sweeping debris from walkways and driveways and hose cleaning them during appropriate climatic and water use conditions. 1.3.1.9 Cleaning the HU and gym areas1.3.7.1 Worker health and safety including Personal Protective Equipment (PPE) Worker Training and Health and Safety. The Contractor shall ensure that all workers are trained on safe and effective disinfection procedures as well as measures for protecting themselves including fastidious hygiene practices and personal protective equipment. The Contractor shall provide all protective measures that at a minimum will include those identified on the disinfectant labeling. Generally, personal protective equipment is anticipated to include impervious disposable gloves and eye protection.Prevent cross-contamination by exercising the task objectives consistently. 1.3.2.1 Polishing all brass surfaces including door and window handles, plaques. 1.3.2.2 Dusting tops of tall furniture, tops of picture frames and areas not covered in daily dusting. 1.3.2.3 Spot cleaning baseboards and walls. 1.3.2.6 Dusting windowsills and blinds. 1.3.2.8 Cleaning of Health Unit, (twice per week), including bathroom and vacuum of carpets. 1.3.3.5 Separate recyclables and transport recyclables from waste room to disposal area.1.3.2.4 Polishing floors as needed. 1.3.2.5 Shampooing (small area spot clean as needed) carpets. 1.3.3.1 Cleaning major appliances inside and out including vacuuming dust from around motor areas. 1.3.3.2 Wiping window blinds with a damp cloth to ensure that all smudges are removed. 1.3.3.3 Cleaning inside window glass and sash of smudges and accumulated dirt. See Attachment 2 for cleaning instructions of FEBR windows. 1.3.3.4 Moving all furniture and vacuuming or polishing the floor under the furniture as appropriate. ✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔✔SAMPLE ONLY WILL BE MODIFIED PER RFP REQUIREMENTS 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDOWILL INCORPORTATE TASKS AND FREQUENCIES PER PERFORMANCE WORK STATEMENT498 (48,30(17 6833/< /,67 48$57(5/< (48,30(17 v 1(:%$77(5<$8726&58%%(581,76:,7+%586+ 3$'6 v )/2250$&+,1(632/,6+$1':$; v :(7'5<9$&8806*$/ v '8$/&/($1',57<:$7(558%%(50$,':5,1*(56&2/25 &2'(' v :(7)/2256,*16(;(&87,9(6(5,(6 v 0,&52),%(50236&2/25&2'(':(7'5<0233,1* 6<67(0 v 35(6685(:$6+(5 v :$6+(5'5<(5)25/$81'5<2)0,&52),%(56212)) 6,7( v -$1,725,$/&$576 v &$53(7&/($1(5(;75$&725 v 6,/(179$&&8806 v /$''(566&$))2/'6$1'27+(5722/6 v -$1,725,$/(;3(1'$%/(6LHWRLOHWSDSHUWRZHOVVRDSHWF 8 27+(548$57(5/<2%-(&7,9(6 8 (9(5<0217+6 03"0 7$6.2%-(&7,9(5(48,5(0(17 6(0,$118$/ v 27+(56(0,$118$/2%-(&7,9(6 $118$/ v 27+(5$118$/2%-(&7,9(6 v 7(0325$5<5(48(67 $'',7,21$/6(59,&(6 1.3.4.1 Washing the outsides of the windows. When completed the windows shall be free of smudges, lint, or streaks from the surfaces. 1.3.4.2 Removing and washing window blinds. 1.3.4.3 Shampooing the entire surface of carpets in the high traffic areas. 1.3.4.4 Cleaning and sanitizing the trash holding area. 1.3.4.5 Dusting and wiping light fixtures and chandeliers. When completed, the light fixtures shall be free from bugs, dirt, grime, dust, and marks. 1.3.5.1 Polish the floors of all the floors of the building. See Appendix 3 for polishing general indications. 1.3.5.2 Shampooing carpets in all areas. This activity may not take place at once, but the cleaning of carpets may be distributed by area or by requirement of the user. 1.3.5.3 Shampooing of chairs and sofas (the ones with fabric on the seat). This activity may not take place at once, but the cleaning of chairs may be distributed by area. 1.3.5.4 Cleaning window treatments as required. 1.3.5.6 Cleaning parking lots as needed with parking lot vacuum/sweeper. 1.3.6.1 Cleaning gutters and down spouts of all collected debris. 1.3.6.2 Cleaning of windows blinds of the offices, this may not occur all at once, but as scheduled. 1.3.6.3 Shampooing of the carpets of Marine House. This activity will be programed under request and authorization of the officers 1.3.7 TEMPORARY/ADDITIONAL SERVICES FOR DISINFECTION/CLEANING: Repeated Disinfection Services. Disinfection may be required to be repeated in the same areas or performed in other spaces in the facilities. The COR shall identify these spaces as described in 1.2.1. Contractor shall coordinate with the COR to provide these additional services. The COR shall direct performance of ordered services on an as needed basis. The Contractor shall include in its next regular invoice details of the temporary additional services and, if applicable, materials, provided and requested under temporary additional services. The Contractor shall also include a copy of the CORs written confirmation for the temporary additional services.SAMPLE ONLY WILL BE MODIFIED PER RFP REQUIREMENTS 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO WILL INCORPORTATE TASKS AND FREQUENCIES PER PERFORMANCE WORK STATEMENT 499 7(&+12/2*< 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO I¾±»¾Ès¾ÝĘU«±¤±ÝĘs«Ęs»»¤sÈ±«Â 500 inventaro Control de Inventarios Login Account Password Remember me Login oc Control Panel Inventory Output Inventory Entry 01 Inventory Order Requisitions Listings zona 16 #3 Embajada zona 16 #4 Embajada zona 16 01/Ago/2023 01/Ago/2023 Main Products Month 0]Inventory Inventory Warehouse Main Excel PDF Print Search: #ID Name Unit 35 A1 Papel Mini CJ Jumbo (Cajas) 36 A2 Papel Scott PZ (Pardos) 37 A3 Servilletas CJ Kleenex (Cajas) 43 A4 Bolsas PZ Grandes 0 Order Requisitions Order Requisitions Excel PDF Print Search: Supplier Referenc#Date No data available ir Show 10 entries Showing 0 to 0 of 0 entries Previous Next "11-*$"5*0/4$3&&/4)054 )0.&4$3&&/&.1-0:&&$)&$,-*45 26"-*5:"4463"/$& 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO I¾±»¾Ès¾ÝĘU«±¤±ÝĘs«Ęs»»¤sÈ±«Â &20,1*0$5&+ 501 CREATED BY HIGH MAINTENANCE SERVICES Scan code Google Fi 5:53 p.m. Men Restroom US EMBASSY LOBBY VISITOR MENS BATHROOM Tasks Select All Clean and disinfect mirrors. Clean sanitary napkin receptacles and wipe with a disinfectant. Toilets and urinals to be cleaned and sanitized inside and outside.Polish bright work. "11-*$"5*0/4$3&&/4)054 &.1-0:&&4"%%5"4,4 3&1035803,/05&4 46 #.*4 4 *0/4$3&&/ 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO I¾±»¾Ès¾ÝĘU«±¤±ÝĘs«Ęs»»¤sÈ±«Â 502 Add a task Work notes Use this section to add your work notes,reasons why you could not perform the task,etc Pictures "11-*$"5*0/4$3&&/4)054 5*.&."/"(&.&/5-"45$-&"/&%5*.&45".1"/:0/& $"/-&"7&'&&%#"$,"11 %08/-0"%*4/053&26*3&% 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO I¾±»¾Ès¾ÝĘU«±¤±ÝĘs«Ęs»»¤sÈ±«Â 503 CREATED BY HIGH MAINTENANCE SERVICES Clocked in since: OOh OOm 07s hours Take a break Clock out Scan code This area was last cleaned at: Wed Mar 17 2021 18:04:39 GMT-0400 (Eastern Daylight Time) If you are having any issues with the cleanliness of this area,please leave a message!! Ill AREA:TASK:FREQUENCY: Ofﬁces Surfaces Reception Conference Rooms ____________ ___________ ____________ ____________ ____________ ____________ ____________ ____________ ____________ ____________ Empty all trash receptacles and replace liners as needed. Remove trash to a collection point. Vacuum carpeting. Clean, disinfect, polish drinking fountain/water cooler. Disinfect all IPSJ[POUBM surfacesincluding GJMF,XJOEPXTJMMT HVFTU chairs, tables, and pictures. Damp wipe all horizontal surfaces BOEDPGGFFTUBUJPOTto remove coffee rings and spillage. Dust and disinfect EFTL LFZCPBSEBOEtelephones. Dust mop hard surface ﬂoors with a treated dust mop. Damp mop hard surface ﬂoors to remove any Tpillage from soiled areas. Damp wipe entryway and clean ﬁngerprints from entrance glass. $lean partition glass. Breakroom Lunchroom Lounge Kitchenettes ____________ ____________ ____________ ____________ ____________ ____________ ____________ ____________ ____________ ____________ ____________ Lunch/Breakroom All trash receptacles are to be emptied and trash removed to a collection point. Dust mop hard surface ﬂoors with a treated dust mop. Damp mop hard surface ﬂoors to remove spillage from soiled areas. Clean and EJTJOGFDUtables and chairs. Spot clean walls near trash receptacles. Clean fronts, tops, and sides of trash receptacles with a disinfectant. Clean and polish drinking fountain/water cooler. Damp wipe FOUJSFcountertops to remove coffee rings and spillage. Clean and sanitize sink. Reﬁll Dispenser. Spot clean cabinets and exterior of appliances to present a neat appearance. Restroom Cleaning ____________ ____________ ____________ ____________ ____________ ____________ Clean and disinfect mirrors. Clean sanitary napkin receptacles and wipe with a disinfectant. Toilets and urinals to be cleaned and sanitized inside and outside. Polish bright work. Toilet seats to be cleaned on both sides using a disinfectant. Disinfect partitions, doors, and top of mirror and frames. Mop and rinse restroom ﬂoors with a disinfectant. Floors ____________ ____________ ____________ Vacuum carpeted and non-carpeted areaT Remove all paper clips, staples and other debris from around desks, tables, credenzas, display units, ﬁling cabinets. Dust mop all hard surface ﬂoor areas. Wet mop all hard surface ﬂoor areas. Elevators ____________ ____________ ____________ ____________ ____________ Vacuum/remove debris and mop ﬂoor. Wipe down BOEEJTJOGFDUi nterior %BJMZ and XJQFexterior (each ﬂoor) of cab including track corridor. Remove any stains and ﬁngerprints. Leave natural shine. Disinfect buttons. Entrances Lobby Common Areas ____________ ____________ ____________ ____________ ____________ ____________ ____________ ____________ ____________ ____________ Clean and disinfect surfaces. Mop ﬂoors with ﬂoor cleaner. Perform dusting on horizontal surfaces. Perform dusting on vertical surfaces. Trash removal and replace can liner. Clean glass. Sweep ﬂoors. Vacuum carpets. Dust baseboards. 0GGJDFFOUSBODFTBOESFDFQUJPOBSFBT Stairwells ____________ ____________ Sweep and remove debris. Clean and disinfect doors handlesBOE SBJMT. 8PSLGPSDF.BOBHFNFOU "QQMJDBUJPO5BTLNBOBHFNFOU POCPBSEJOH 4".1-& 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO I¾±»¾Ès¾ÝĘU«±¤±ÝĘs«Ęs»»¤sÈ±«Â To be scheduled To be scheduled To be scheduled To be scheduled To be scheduled To be scheduled To be scheduled Daily Daily Daily Daily Daily Daily Daily As needed Daily Daily Daily Daly Daily As needed Daily Daily Daily Daily Daily Daily As needed As needed As needed Daily Daily / Track (as needed) Daily Daily Daily Daily / others as needed Daily / others as needed Daily Daily Weekly Weekly Daily As needed As needed As needed to be schedualed Daily 504 Workforce Management Application Task management onboarding i-MS Chair handles & backs Coffee machines & pots Counter tops Desktops Door glass Door handles & edges Elevator buttons & doors HI TOUCH POINT COVID RESPONSE AND GUIDELINE COMPLIANCE C O VID 19 HIGH TOUCH CLEANING CHECKLIST High touch items are among the most pathogen heavy surfaces in your facility. Routine cleaning and disinfecting of these items along with frequent hanEs washing are critical to breakinH the chain of infection and creating Bclean, safe, and healthy enviroONFOU. 8FFODPVSBHFBMMPGGJDFPDDVQBOUTUPIFMQFOIBODFFGGPSUTBOESFEVDFFYQPTVSFCZTBOJUJ[JOH UIFCFMPXJUFNTGSFRVFOUMZUISPVHIPVUUIFEBZ Break room areas (appliances, sinks, chairs & tables) Restrooms (restroom ﬂush handles, toilet paper dispensers) GATHERING PLACES. Conference room tables & chairs Open shared workspaces %JTQFOTFST Kiosk buttons Keyboards & mice Light switches MailboYes Microwaves Paper towel dispensers Phones Podiums Printer/fax machines Refrigerator handles & doors Sink faucets & handles Stair rails Staplers & staple removers Tabletops Tape dispensers Time clocks Toaster ovens Trash receptacles Vending machines Water fountains AREA:TASK:FREQUENCY: Supply Janitorial Closet ____________ ____________ ____________ ____________ ____________ Inventory management. Clean sink. Organize supplies. Re-stock supplies. Sweep and mop ﬂoors. Weekly ____________ ____________ ____________ ____________ Weekly Cleaning. Ofﬁces, Lobby, Lunchroom, Conference Room. Dust all vertical surfaces of desks, ﬁle cabinets, chairs, tables and other ofﬁce furniture. Thoroughly vacuum all carpeting, taking care to get into corners, along edges and beneath furniture. Damp mop hard surface ﬂoors, taking care to get into corners, along edges and beneath furniture. Clean interior of refrigeratorT/Toss old food. Monthly ____________ ____________ ____________ ____________ ____________ Complete all high dusting not reached in the above-mentioned cleaning. Vacuum all upholstered furniture. Remove cobwebs. Dust blinds and window shades. Clean baseboards carpet edges,ﬂoor cornersBOE"$WFOUTXJUITXJGGFSEVTUFS. /DXQGU\ Prevent Cross Contamination ELOOHGVHSDUDWHO\ ____________ ____________ ____________ .BJOUBJO stock of fresh microﬁber cloths. Color coded microﬁber system. On-site/Off-site laundry. C O R O NAVIRUS EXP OSURE RE D U C T IO NNOTES: __________________________________________________________________________________________________________________ __________________________________________________________________________________________________________________ __________________________________________________________________________________________________________________ __________________________________________________________________________________________________________________ __________________________________________________________________________________________________________________ 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO I¾±»¾Ès¾ÝĘU«±¤±ÝĘs«Ęs»»¤sÈ±«Â As needed As needed As needed As needed As needed As needed Daily Both To be scheduled To be scheduled To be scheduled Scheduled 1x weekly *Billed Separately Scheduled monthly Scheduled monthly * Billed Separately * Billed Separately ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ 505 ooo ooooJ\ooo ÀȲƊǞȁƊȁƮ(ƵɨƵǶȌȯ ȄژƷȂȲǚƌȽǠȽژȏȄژȽƌǑƷɋɲژڹژɋȵƌǠȄǠȄǒ ɓȵژɋȵƌǠȄǠȄǒژȲȵȏǒȵƌȂژƷȂȲǚƌȽǠɼƷȽژƨƷȽɋژȲȵƌƩɋǠƩƷȽژƌȄưژɬȏȵǵǠȄǒژȽƌǑƷǹɲژƌȄưژɋǚȏȽƷژȵƷȴɓǠȵƷưژƨɲژɋǚƷژǹƌɬژƌȄưژ ȲȵȏǑƷȽȽǠȏȄƌǹژƌƩƩȵƷưǠɋƌɋǠȏȄȽژƌȄưژȽƌǑƷɋɲژȽɋƌȄưƌȵưȽژȽɓƩǚژƌȽژ°OژƌȄưژɬǠǹǹژǠȄƩǹɓưƷژƌǹǹژǹȏƩƌǹژȽƌǑƷɋɲژȵƷǒɓǹƌɋǠȏȄȽِژ ¾ȵƌǠȄǠȄǒژ¥ȵȏǒȵƌȂي ɓȵژǠȄȽɓȵƌȄƩƷژƷɱȲƷȵǠƷȄƩƷژȵƌɋǠȄǒژǠȽژ׎ِגًژƨƷƩƌɓȽƷژȏǑژȏɓȵژɋȵƌǠȄǠȄǒژȲȵȏǒȵƌȂژɬƷژǚƌɫƷژȵɓȄژȏɓȵژȏȲƷȵƌɋǠȏȄژחחۑژ ƩǹƌǠȂژǑȵƷƷژȽǠȄƩƷژא׎׎גِژ¾ǚǠȽژȲȵȏǒȵƌȂژƷȽɋƌƨǹǠȽǚƷȽژƌژƨƌȽƷǹǠȄƷژɬǚƷȵƷژɬƷژȵƷɋƌǠȄژƷɱȲƷȵǠƷȄƩƷưژƷȂȲǹȏɲƷƷȽژɬǠɋǚژ ɋǚƷژȽǵǠǹǹȽژɋǚƷɲژȄƷƷưژɋȏژȽɓƩƩƷȽȽǑɓǹǹɲژȲƷȵǑȏȵȂژɋǚƷǠȵژǱȏƨȽًژǠȂȲȵȏɫƷژɋǚƷǠȵژƷǑǑǠƩǠƷȄƩɲًژƌȄưژưƷɫƷǹȏȲژȄƷɬژȽǵǠǹǹȽژɋȏژ ƷȄƌƨǹƷژɋǚƷȂژɋȏژƨƷɋɋƷȵژȂƷƷɋژɲȏɓȵژȄƷƷưȽِژ v ¾ƷƩǚȄǠƩƌǹǹɲژȲȵȏǑǠƩǠƷȄɋژɬǠɋǚژƩǚƷȂǠƩƌǹȽًژƷȴɓǠȲȂƷȄɋًژƌȄưژȂƷɋǚȏưȽ v FƌȂǠǹǠƌȵژɬǠɋǚژɋǚƷژȵɓǹƷȽژƌȄưژȵƷǒɓǹƌɋǠȏȄȽژȏǑژɋǚƷژǑƌƩǠǹǠɋɲ v ¾ǚȏȵȏɓǒǚǹɲژɋȵƌǠȄƷưژȵƷǒƌȵưǠȄǒژȽƌǑƷɋɲژȂƌɋɋƷȵȽ v ȏȂȂǠɋɋƷưژɋȏژȲȵȏɫǠưǠȄǒژȏɓɋȽɋƌȄưǠȄǒژƩɓȽɋȏȂƷȵژȽƷȵɫǠƩƷ wƷɬٮOǠȵƷژȵǠƷȄɋƌɋǠȏȄژƌȄưژ¾ȵƌǠȄǠȄǒ %ɓȵǠȄǒژɋǚƷژȽɋƌȵɋٮɓȲژȲǚƌȽƷًژ¥ƌȵɋȄƷȵژ¥ȵȏǱƷƩɋژuƌȄƌǒƷȵȽژƌȄưژ°ɓȲƷȵɫǠȽȏȵȽژƌȵƷژȵƷȴɓǠȵƷưژɋȏژƩȏȄưɓƩɋژɋȵƌǠȄǠȄǒژȽƷȽȽǠȏȄȽژ ƌɋژȏɓȵژƩɓȽɋȏȂƷȵȽټژǹȏƩƌɋǠȏȄȽژǑȏȵژƌǹǹژƷȂȲǹȏɲƷƷȽژɬǚȏژɬǠǹǹژƨƷژɬȏȵǵǠȄǒژƌɋژɋǚƷژǱȏƨژȽǠɋƷِژ ¾ǚƷژƌǒƷȄưƌژǠȄƩǹɓưƷȽي v ȵǠƷȄɋƌɋǠȏȄژƌȄưژǠȄɋȵȏưɓƩɋǠȏȄژɋȏژɋǚƷژǑƌƩǠǹǠɋɲ v ȵǠƷȄɋƌɋǠȏȄژɋȏژȽȲƷƩǠǑǠƩژǑƌƩǠǹǠɋɲژȵɓǹƷȽژƌȄưژȵƷǒɓǹƌɋǠȏȄȽ v °ɋƌȄưƌȵưǠɼƷưژȲȏǹǠƩǠƷȽژƌȄưژȲȵȏƩƷưɓȵƷȽ v °ƌǑƷɋɲژɋȵƌǠȄǠȄǒ v ¨ƷȽɋȵȏȏȂژƩǹƷƌȄǠȄǒژȲȵȏƩƷưɓȵƷȽ v ȏȂȂȏȄژƌȵƷƌژƩǹƷƌȄǠȄǒژȲȵȏƩƷưɓȵƷȽ v -ɱȲǹƌȄƌɋǠȏȄژȏǑژǠȄưǠɫǠưɓƌǹژǱȏƨژưɓɋǠƷȽ 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO Pª»¤ĘU¾s««Ęs«ĘÖ¤±»ª«ÈĘI¤s« 506 v ¥ȵȏȲƷȵژɓȽƷژȏǑژɋȏȏǹȽژƌȄưژƷȴɓǠȲȂƷȄɋ v ÞƌȽɋƷژưǠȽȲȏȽƌǹ v °ȂȏǵǠȄǒژȵƷǒɓǹƌɋǠȏȄȽ v °ǠɋƷژȽƷƩɓȵǠɋɲژȵɓǹƷȽژƌȄưژȲȵȏƩƷưɓȵƷȽ v ÅȄǠǑȏȵȂژưǠȽɋȵǠƨɓɋǠȏȄ v %ȵɓǒٮFȵƷƷژÞȏȵǵȲǹƌƩƷژƌȄưژ¥ȏǹǠƩɲژ¾ȵƌǠȄǠȄǒژǑȏȵژȽƷȵɫǠƩƷژɬȏȵǵƷȵȽژƩȏȄƩƷȄɋȵƌɋƷژȏȄژȽȲƷƩǠǑǠƩژɬȏȵǵژɋƌȽǵȽِ àƵƵɮȯƵƧɈƊǶǶƵǿȯǶȌɯƵƵȺɈȌƦƵȯȲȌǏƵȺȺǞȌȁƊǶǶɯɈȲƊǞȁƵƮƊȁƮȺɐȯƵȲɨǞȺƵƮىǶǶȺɐȯƵȲɨǞȺȌȲȺǿɐȺɈƊƮǘƵȲƵɈȌɈǘƵǏȌǶǶȌɩǞȁǐك v %ƷȂȏȄȽɋȵƌɋƷژƷƌƩǚژȽɋƷȲژȏǑژɋǚƷژƩǹƷƌȄǠȄǒژȲȵȏƩƷȽȽ v ¨ƷɫǠƷɬژɋǚƷژǠȂȲȏȵɋƌȄƩƷژȏǑژɬǚɲژƌژɋƌȽǵژǠȽژȲƷȵǑȏȵȂƷưژǠȄژƌژȽȲƷƩǠǑǠƷưژȂƌȄȄƷȵ v ȏȄȽɋȵɓƩɋǠɫƷǹɲژǒɓǠưƷژƷȂȲǹȏɲƷƷȽژɬǚǠǹƷژɋǚƷɲژȲƷȵǑȏȵȂژɋǚƷǠȵژɋƌȽǵȽ v -ɱȲǹƌǠȄژɋǚƷژȽƌǑƷژɓȽƷژȏǑژƩǚƷȂǠƩƌǹȽژƌȄưژƷȴɓǠȲȂƷȄɋ v ¾ȵƌǠȄژƷȂȲǹȏɲƷƷȽژɋȏژȲƷȵǑȏȵȂژɫǠȽɓƌǹژǠȄȽȲƷƩɋǠȏȄȽژȏǑژɋǚƷǠȵژƌȵƷƌژƨƷǑȏȵƷژƩȏȂȲǹƷɋǠȄǒژɬȏȵǵًژƌȄưژɋȏژƩȏȵȵƷƩɋژƌȄɲ ưƷǑǠƩǠƷȄƩǠƷȽژȄȏɋƷư v UȄȽȲƷƩɋژƩȏȂȲǹƷɋƷưژɬȏȵǵژƌȄưژȵƷɋȵƌǠȄژɬǚƷȄژȄƷƩƷȽȽƌȵɲ v ȏȂȲǹƷɋƷژǠȄǠɋǠƌǹژɋȵƌǠȄǠȄǒژƩǚƷƩǵǹǠȽɋژǑȏȵژƷƌƩǚژƷȂȲǹȏɲƷƷًژƌȄưژȵƷɫǠƷɬژȲƷȵǑȏȵȂƌȄƩƷژƌɋژȵƷǒɓǹƌȵژǠȄɋƷȵɫƌǹȽ ²ƊǏƵɈɯÀȲƊǞȁǞȁǐ ȏȄɋȵƌƩɋɓƌǹژȵƷȴɓǠȵƷȂƷȄɋȽژɬǠǹǹژȵƷȴɓǠȵƷژɋȵƌǠȄǠȄǒژɬǠɋǚژƌژǚƷƌɫɲژƷȂȲǚƌȽǠȽژȏȄژȲƷȵǑȏȵȂǠȄǒژɬȏȵǵژǠȄژƌژȽƌǑƷژȂƌȄȄƷȵِژ ¾ȏȲǠƩȽژƩȏɫƷȵƷưژǠȄƩǹɓưƷژƷȂȲǹȏɲƷƷژȲȵȏǑƷȽȽǠȏȄƌǹǠȽȂًژ¥¥-ژɓɋǠǹǠɼƌɋǠȏȄًژOƌɼȏȂȂًژOîu¾ًژu°%°ًژƩǹƷƌȄǠȄǒژ ȲȵȏưɓƩɋȽًژƌȄưژƩȏȵȵƷƩɋǠɫƷژƌƩɋǠȏȄژǑȏȵژɫǠȏǹƌɋǠȄǒژȽƌǑƷɋɲژȲȏǹǠƩǠƷȽژƌȄưژȵɓǹƷȽِژ¾ǚǠȽژɋȵƌǠȄǠȄǒژȲȵȏǒȵƌȂژǠȽژǠȂȲǹƷȂƷȄɋƷưژ ȏȄژƌȄژȏȄٮǒȏǠȄǒژƨƌȽǠȽژɓȽǠȄǒژǚƌȄưȽٮȏȄژȲȵƌƩɋǠƩƷٕژȂƌɲژǠȄƩǹɓưƷژȲƷȵȽȏȄƌǹًژɫǠưƷȏɋƌȲƷًژƌȄưژƩǹƌȽȽȵȏȏȂژǠȄȽɋȵɓƩɋǠȏȄٕژ ȽƷȂǠȄƌȵȽًژƌȄưژȏȄٮȽǠɋƷژɋȵƌǠȄǠȄǒژȂƷƷɋǠȄǒȽِژƷǑȏȵƷژƨƷǠȄǒژƌȽȽǠǒȄƷưژɋȏژƌژȽȲƷƩǠǑǠƩژǱȏƨژȽǠɋƷًژȲƌȵɋȄƷȵژɫƷȄưȏȵȽژƌȵƷژ ƌȽǵƷưژɋȏژȲȵȏɫǠưƷژƷȂȲǹȏɲƷƷȽژƌژȂƌȄưƌɋȏȵɲژɋȵƌǠȄǠȄǒژɬǚǠƩǚژǠȄƩǹɓưƷȽژɋȏȲǠƩȽژƌưưȵƷȽȽǠȄǒژƨƌȽǠƩژȽƌǑƷɋɲًژȏȲƷȵƌɋǠȏȄȽًژ ƌȄưژǚɓȂƌȄژȵƷǹƌɋǠȏȄȽِ uƌȄưƌɋȏȵɲژɋȵƌǠȄǠȄǒژɋȏȲǠƩȽژǠȄƩǹɓưƷي v GƷȄƷȵƌǹژ°ƌǑƷɋɲژƌȄưژƩƩǠưƷȄɋژ¥ȵƷɫƷȄɋǠȏȄژ¾ȵƌǠȄǠȄǒژɬǠɋǚژ°ǠɋƷٮ°ȲƷƩǠǑǠƩژ°ƌǑƷɋɲژUɋƷȂȽ v ¥ȵȏȲƷȵژkǠǑɋǠȄǒ v ¥ȵƷɫƷȄɋǠȄǒژ°ǹǠȲȽٖ¾ȵǠȲٖFƌǹǹȽ v ƌȵȵǠƩƌưƷژ¥ȵȏǒȵƌȂ v -ȵǒȏȄȏȂǠƩژ°ƌǑƷɋɲژ٢ǒƷȄƷȵƌǹژƨȏưɲٮȂƷƩǚƌȄǠƩȽ٣ v ¨ƷɋɓȵȄٮɋȏٮÞȏȵǵژ¥ȵȏǒȵƌȂ 59 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO Pª»¤ĘU¾s««Ęs«ĘÖ¤±»ª«ÈĘI¤s« 507 We expect all employees to be professionally trained and supervised.All supervisors must adhere to the following: Safety Training ²R!ȌǿȯǶǞƊȁƧƵÀȲƊǞȁǞȁǐɩǞɈǘ²ǞɈƵ٧²ȯƵƧǞǏǞƧ²ƊǏƵɈɯXɈƵǿȺ v ¾ƌȽǵژOƌɼƌȵưژ%ƷɋƷȵȂǠȄƌɋǠȏȄژȵƷǹƌɋƷưژɋȏژɋǚƷژǱȏƨ v ÞǚƌɋژƌȵƷژɋǚƷژǚƌɼƌȵưȽژȏǑژɋǚƷژǱȏƨ v ÞǚƌɋژƌȵƷژɋǚƷژ¥¥-ژȵƷȴɓǠȵƷȂƷȄɋȽژǑȏȵژɋǚȏȽƷژǚƌɼƌȵưȽ v OƌɼȏȂژٖژOîu¾ژ٢u°%°ژ٫ژǚƷȂǠƩƌǹژƌɬƌȵƷȄƷȽȽ٣ v -ȂƷȵǒƷȄƩɲژ-ɫƌƩɓƌɋǠȏȄژ٢ƷɱǠɋژȵȏɓɋƷȽژƌȄưژǒƌɋǚƷȵǠȄǒژƌȵƷƌ٣ v ¨ƷȲȏȵɋǠȄǒژƌƩƩǠưƷȄɋȽ ªƵƧɐȲȲƵȁɈÀȲƊǞȁǞȁǐ²ƵȺȺǞȌȁȺ ¥ƷȵǠȏưǠƩƌǹǹɲًژOu°ژɬǠǹǹژȲƷȵǑȏȵȂژȵƌȄưȏȂژȽǠɋƷژȽɓȵɫƷɲȽًژƷɫƌǹɓƌɋǠȏȄȽژɋȏژưƷɋƷȵȂǠȄƷژȽɋȵƷȄǒɋǚȽژƌȄưژɬƷƌǵȄƷȽȽƷȽًژ ƌȄưژɬǚƷȄژȄƷƷưƷưژȵƷȴɓƷȽɋژȲƌȵɋȄƷȵژɫƷȄưȏȵȽژɋȏژƩȏȄưɓƩɋژȵƷƩɓȵȵƷȄɋژɋȵƌǠȄǠȄǒژȽƷȽȽǠȏȄȽژǑȏȵژƩɓȵȵƷȄɋژƌȄưژ ȵƷȲǹƌƩƷȂƷȄɋژƷȂȲǹȏɲƷƷȽژƌɋژɋǚƷژƩɓȽɋȏȂƷȵټȽژȽǠɋƷِژ¾ǚƷȽƷژȽƷȽȽǠȏȄȽژƌȵƷژɋƷƩǚȄǠƩƌǹژǠȄژȄƌɋɓȵƷژƌȄưژƩȏȄƩƷȄɋȵƌɋƷژȏȄژ ȽȲƷƩǠǑǠƩژǱȏƨژɋƌȽǵȽژƌȄưژưɓɋǠƷȽِژ-ȂȲǹȏɲƷƷȽژƌȵƷژɋȵƌǠȄƷưژǠȄژǒȵȏɓȲȽژȽȲƷƩǠǑǠƩژɋȏژɋǚƷǠȵژǑɓȄƩɋǠȏȄِژOu°ژɬǠǹǹژȵƷȴɓǠȵƷژ ȏɓȵژǹȏƩƌǹژȲƌȵɋȄƷȵژɋȏژȲƷȵǑȏȵȂژɓȄƌȄȄȏɓȄƩƷưژȽǠɋƷژɫǠȽǠɋȽژƌȽژɬƷǹǹژǑȏǹǹȏɬǠȄǒژɋǚƷژȽƌȂƷژƩȵǠɋƷȵǠƌِژ ¾ȏȲǠƩȽژǑȏȵژɋǚƷȽƷژȽƷȽȽǠȏȄȽژǠȄƩǹɓưƷي UȄɋƷȵưǠȽƩǠȲǹǠȄƌȵɲژɋȵƌǠȄǠȄǒژǠȄژǱȏƨٮȽȲƷƩǠǑǠƩژɋȏȲǠƩȽژ٢ƷِǒًِژǑǹȏȏȵژɬƌɱǠȄǒًژȵƷȽɋȵȏȏȂژƩǹƷƌȄǠȄǒًژȂƌƩǚǠȄƷٮƩǹƷƌȄǠȄǒژ ɋƷƩǚȄǠȴɓƷȽًژɬǠȄưȏɬژƩǹƷƌȄǠȄǒژȽɋƌȄưƌȵưȽًژƌȄưژȵƷȴɓǠȵƷȂƷȄɋȽًژƷɋƩِ٣ °ƌǑƷɋɲژǠȽȽɓƷȽژ٢ƷِǒًِژƌƩƩǠưƷȄɋژǠȄɫƷȽɋǠǒƌɋǠȏȄژȲȵȏƩƷưɓȵƷȽًژǚƌɼƌȵưژưƷɋƷƩɋǠȏȄٖǠȄȽȲƷƩɋǠȏȄًژȵƷɋɓȵȄٮɋȏٮɬȏȵǵژ ȲȵȏǒȵƌȂȽًژƷɋƩِ٣ ȏȂȂɓȄǠƩƌɋǠȏȄژȽǵǠǹǹȽ ɓȽɋȏȂƷȵژȵƷǹƌɋǠȏȄȽژȽǵǠǹǹȽ °ȲƷƩǠƌǹǠɼƷưژɋȵƌǠȄǠȄǒژȵƷȴɓǠȵƷưژƩƷȵɋǠǑǠƩƌɋǠȏȄ °ɓȲƷȵɫǠȽȏȵژ%ƷɫƷǹȏȲȂƷȄɋژ¾ȵƌǠȄǠȄǒ ȏȂȲǹǠƌȄƩƷژȏǑژɋǚƷژȽɋƌǑǑژɋȏژɋȵƌǠȄǠȄǒژǠȽژȂƷƌȽɓȵƷưژƌȄưژɋȵƌƩǵƷưژƨɲژȵƷȴɓƷȽɋǠȄǒژȵƷƩȏȵưȽژȏǑژƌɋɋƷȄưƌȄƩƷًژǱȏƨژ ȲƷȵǑȏȵȂƌȄƩƷًژɋƷȽɋȽًژƷɋƩِژɋȏژƷȄȽɓȵƷژƌǹǹژƷȂȲǹȏɲƷƷȽژƌȵƷژȵƷƩƷǠɫǠȄǒژɋǚƷژȲȵȏȲƷȵژǹƷɫƷǹژȏǑژɋȵƌǠȄǠȄǒِ 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO Pª»¤ĘU¾s««Ęs«ĘÖ¤±»ª«ÈĘI¤s« 508 OSHA Compliance Training with Site-Specific Safety Items Recurrent Training Sessions §ǶƊȁɈȌ0ȁȺɐȲƵ©ɐƊǶǞɈɯȌǏ²ƵȲɨǞƧƵȺ ¥ǹƌȄژȏǑژƷȄȽɓȵǠȄǒژȴɓƌǹǠɋɲژȏǑژȽƷȵɫǠƩƷȽژǠȄƩǹɓưǠȄǒژƨɓɋژȄȏɋژǹǠȂǠɋƷưژɋȏژƩȏȄɋȵƌƩɋژƌưȂǠȄǠȽɋȵƌɋǠȏȄژƌȄưژȏɫƷȵȽǠǒǚɋ °ƷƷژ§°¥ژƌưưȵƷȽȽƷȽژǚȏɬژȴɓƌǹǠɋɲژɬǠǹǹژƨƷژƷȄȽɓȵƷưژǑȏȵژƌǹǹژ°ÞژȵƷȴɓǠȵƷȂƷȄɋȽژȲǹɓȽژƩȏȄɋȵƌƩɋژƌưȂǠȄٖȏɫƷȵȽǠǒǚɋژ ٢ȂƌȄƌǒƷȂƷȄɋ٣ ٢ȲƷȵȽȏȄȄƷǹژȵƷȴɓǠȵƷȂƷȄɋȽ٣ ٢ȂƌȄƌǒƷȂƷȄɋٖȽɓȲƷȵɫǠȽǠȏȄ٣ ©ɐƊǶǞɈɯȺȺɐȲƊȁƧƵ§ȲȌǐȲƊǿك -ȄȽɓȵǠȄǒژuƷƌȽɓȵƌƨǹƷژ§ɓƌǹǠɋɲ ɓȵژȲɓȵȲȏȽƷژǠȽژɋȏژƷȽɋƌƨǹǠȽǚژƌژȴɓƌǹǠɋɲژƩɓǹɋɓȵƷژɋǚƌɋژǑȏƩɓȽƷȽژȏȄژƩɓȽɋȏȂƷȵȽًژǠȄɫȏǹɫƷȽژƷȂȲǹȏɲƷƷȽًژȂƷƌȽɓȵƷȽژ ȲƷȵǑȏȵȂƌȄƩƷًژƌȄưژǠȽژƩȏȄɋǠȄɓȏɓȽǹɲژǠȂȲȵȏɫǠȄǒِژ ¾ȏژƌƩǚǠƷɫƷژɋǚƌɋژǒȏƌǹژɬƷژƷȂȲǹȏɲژƌژɓȄǠǑɲǠȄǒژȴɓƌǹǠɋɲژȽɲȽɋƷȂژɋǚƌɋژȲǹƌƩƷȽژƌژɫƌȵǠƷɋɲژȏǑژȲȵȏƩƷȽȽƷȽژǠȄɋȏژƌژȽǠȄǒǹƷژ ǑȵƌȂƷɬȏȵǵِژ¾ǚǠȽژǑȵƌȂƷɬȏȵǵژǠȽژɋƌǵƷȄژɋȏژȄƷɬژƩɓȽɋȏȂƷȵȽژƌȄưژȽƷȵɫǠƩƷژȲƌȵɋȄƷȵȽژƌȽژƌژȽɋƌȵɋǠȄǒژȲȏǠȄɋژǑȵȏȂژɬǚǠƩǚژɋȏژ ƩɓȽɋȏȂǠɼƷژȲȵȏǱƷƩɋٮȽȲƷƩǠǑǠƩژȴɓƌǹǠɋɲژȲȵȏǒȵƌȂȽِژ §ɓƌǹǠɋɲژuƌȄƌǒƷȂƷȄɋژ°ɲȽɋƷȂژɫǠƌژ§¨ژȏưƷȽيژ v ȄƌǹɲɼǠȄǒژǠȄȽȲƷƩɋǠȏȄȽژƌȄưژȽɓȵɫƷɲȽ v ɓɋȏȂƌɋǠȄǒژɬȏȵǵژȏȵưƷȵژȂƌȄƌǒƷȂƷȄɋ v -ȽɋƌƨǹǠȽǚǠȄǒژƌȄưژɋȵƌƩǵǠȄǒژƌƩƩȏɓȄɋƌƨǠǹǠɋɲ v ȏȄɋǠȄɓƌǹǹɲژǠȂȲȵȏɫǠȄǒژȲȵȏƩƷȽȽƷȽ °ɋȵƌɋƷǒǠƩƌǹǹɲژȲǹƌƩƷưژ§¨ژƩȏưƷȽژƌȵƷژȄȏɋژȏȄǹɲژȲǹƌƩƷưژɋȏژƩȏǹǹƷƩɋژǑƷƷưƨƌƩǵژǑȵȏȂژǑƌƩǠǹǠɋɲژȲƌɋȵȏȄȽژƌȄưژǒȏɫƷȵȄȂƷȄɋژ ƷȂȲǹȏɲƷƷȽِژ¾ǚƷژǑƷƷưƨƌƩǵژȲȵȏɫǠưƷưژȏȄژ§¨ژƩȏưƷȽژǠȽژɋȵƌƩǵƷưژƌȄưژȂȏȄǠɋȏȵƷưژɋȏژǠưƷȄɋǠǑɲژƌȵƷƌȽژȏǑژȽɋȵƷȄǒɋǚƷȄȽژ ƌȄưژɬƷƌǵȄƷȽȽƷȽِژ¾ǚƷژ§u°ژ§¨ژ¥ȵȏǒȵƌȂژǠȽژǠȄژȲǚƌȽƷژ׏ژưƷɫƷǹȏȲȂƷȄɋژɬǚƷȵƷژǑƷƷưƨƌƩǵژȂƷɋȵǠƩȽژƌȵƷژɓȽƷưژǑȏȵژ ƩȏȄɋǠȄɓȏɓȽژǠȂȲȵȏɫƷȂƷȄɋِژ¥ǚƌȽƷژאژ٢ƌɫƌǠǹƌƨǹƷژǹƌɋƷژא׎א׏٣ًژɬǠǹǹژƷȄƌƨǹƷژƷȂȲǹȏɲƷƷȽژɋȏژȽƩƌȄژ§¨ژƩȏưƷȽژȲȵȏɫǠưƷژ ǠȂȲȏȵɋƌȄɋژƷȂȲǹȏɲƷƷژǑƷƷưƨƌƩǵًژȵƷȲȏȵɋژƨȵȏǵƷȄژǑǠɱɋɓȵƷȽًژǹǠǒǚɋژƨɓǹƨȽًژƌȄưژȏɋǚƷȵژȵƷǹƷɫƌȄɋژȵƷȴɓǠȵƷȂƷȄɋȽژɋǚƌɋژȂƌɲژ ƨƷژɓȽƷǑɓǹژǑȏȵژȏɓȵژƩɓȽɋȏȂƷȵȽِژ¾ǚƷژƩȏưƷȽژɬǠǹǹژƌǹȽȏژƨƷژƷȄƩȏưƷưژɋȏژȲȵȏɫǠưƷژƌژƩǚƷƩǵǹǠȽɋژɬǠɋǚژɋǠȂƷȽɋƌȂȲژɋȵƌƩǵǠȄǒژȏǑژ ɬǚƷȄژƌژȽȲƷƩǠǑǠƩژƌȵƷƌژɬƌȽژǹƌȽɋژȽƷȵɫǠƩƷưًژɋǚƷژȄƌȂƷژȏǑژɋǚƷژƷȂȲǹȏɲƷƷژɬǚȏژȽƷȵɫǠƩƷưژǠɋژƌȄưژɬǚƌɋژɬƌȽژưȏȄƷژȏȵژȄȏɋژ ưȏȄƷًژɋƌȽǵȽژɋǚƌɋژƌȵƷژȄȏɋژƩȏȂȲǹƷɋƷưژƌȵƷژƌɓɋȏȂƌɋǠƩƌǹǹɲژƷȂƌǠǹƷưژɋȏژȽǠɋƷژȽɓȲƷȵɫǠȽȏȵȽژǑȏȵژȵƷɫǠƷɬِژ 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO Pª»¤ĘU¾s««Ęs«ĘÖ¤±»ª«ÈĘI¤s« 509 Plan to Ensure Quality of Services i 510 511 512 0RQWHUUH\ 3RQLHQWH $WWQ 0*7 0($0(1'77,7/(2)6,*1(5 513 514 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 515 8VHRUGLVFORVXUHRIWKLVGDWDLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDO 516 4380 SW 74th Avenue Miami, FL. 33155  TOLL FREE +1.888.550.3765 MIAMI +1.786.350.3958 EXT. 6414 info@HighMaintenanceServices.com January 23, 2025 City of South Miami 6130 Sunset Drive South Miami, FL 33143 Subject: Letter of Interest for Janitorial Services Contract Dear Members of the Selection Committee, We are pleased to submit this letter of interest to express our commitment and qualifications to provide exceptional janitorial services to the City of South Miami. South Miami is a special place where my mother and I grew up. I spent most of my youth, after school, at the South Miami public library next to city hall. In 2004, we earned our first mom and pop grant, and it helped start our business in South Miami. Today, we want to give back to the city of pleasant living through our 21 years of experience in delivering professional cleaning and maintenance solutions to municipalities, commercial facilities, and public spaces, HMS is confident in our ability to meet and exceed the requirements outlined in the Request for Proposal (RFP). Our understanding of the City’s goals reflects a shared commitment to maintaining safe, clean, and welcoming public spaces that enhance the quality of life for residents and visitors. By leveraging our experience in similar environments and our familiarity with South Miami's unique local conditions, we are well-positioned to address the specific challenges and expectations associated with this contract. Our Approach and Philosophy At HMS, we prioritize tailored solutions designed to align with the unique needs of each client. Our approach emphasizes: 1.Consistency and Quality: Utilizing a comprehensive quality control program to ensure all services adhere to the highest industry standards. 2.Sustainability: Employing eco-friendly cleaning products and practices to minimize environmental impact while maintaining a healthy environment. 3.Efficiency and Innovation: Integrating advanced equipment and technology to optimize service delivery and achieve cost-effectiveness. 517 4380 SW 74th Avenue Miami, FL. 33155  TOLL FREE +1.888.550.3765 MIAMI +1.786.350.3958 EXT. 6414 info@HighMaintenanceServices.com Commitment to the City of South Miami We recognize the importance of this partnership to the City’s residents and stakeholders. Our team is committed to delivering the highest standard of service, responding promptly to any concerns, and continuously adapting to meet evolving needs. We also emphasize hiring local staff wherever possible, fostering community engagement and economic growth. Our Capability to Meet Requirements HMS is equipped with a dedicated team of trained professionals, advanced cleaning systems, and a robust infrastructure to ensure reliable service delivery. Our previous projects, such as the U.S. Embassy in Guatemala, demonstrate our capability to manage contracts of this scale and complexity effectively anywhere. In summary, HMS is eager to partner with the City of South Miami to provide exceptional janitorial services that reflect the City’s goals and values. We look forward to the opportunity to contribute to the upkeep and enhancement of your facilities and are prepared to collaborate closely to ensure your objectives are fully realized. Thank you for considering our proposal. We are available at your convenience to discuss our approach in greater detail or to provide additional information. Sincerely, Juan Perez President J.Perez Enterprises, Inc. DBA High Maintenance Services 518 CITY OF SOUTH MIAMI REQUEST FOR PROPOSALS (RFP) No. FN2024-17 JANITORIAL SERVICES City of South Miami Commission Mayor Javier Fernández Vice Mayor Brian Corey Commissioner Steve Calle Commissioner Danny Rodriguez Commissioner Lisa Bonich City of South Miami City Hall 6130 Sunset Drive South Miami, Florida 33143 ISSUE DATE: December 18, 2024 PROPOSAL DUE DATE: January 23, 2025 PROPOSAL DUE TIME: 10:00 A.M. PROPOSAL OPENING TIME: 10:30 AM 1 of 92 519 South’Miami THE CITY OF PLEASANT LIVING PUBLIC NOTICE REQUEST FOR PROPOSALS (RFP) No. FN2024-17 JANITORIAL SERVICES NOTICE IS HEREBY GIVEN that the City of South Miami (“City”) is soliciting proposals for Janitorial Services (the “Services”). Interested companies, firms, and individuals (“Proposers”) may obtain a copy of Request for Proposals No. FN 2024-17 (the “RFP”) to be issued on December 18, 2024 at the City of South Miami 6130 Sunset Drive, South Miami, FL 33143 or on the City’s website at www.southmiamifl.gov, or via DemandStar at https://network.demandstar.com/. The RFP contains detailed information about the scope of Services, submission requirements, and selection procedures. All notices and any addenda issued by the City with respect to the RFP will be made available on the City’s website. It is the Proposer’s sole responsibility to ensure receipt of any issued notice or addenda relating to this RFP once posted to the website. The Proposal submission shall be submitted electronically via DemandStar, and marked “Proposal to City of South Miami, RFP No. FN2024-17 for “JANITORAL SERVICES.” Proposals must be received by the City by no later than January 23, 2025 at 10:00 AM. Proposals will be publicly opened through video conferencing using the Zoom platform. Members of the public are invited to view the Proposal opening meeting through Zoom at https://zoom.us/j/3056636339 on January 23, at 10:30 AM or by listening to the Proposal opening meeting on a dedicated phone line by dialing +1-786-635-1003 Meeting ID: 3056636339. Any Proposal submission received after this time and date will be rejected and returned unopened. Proposers are responsible for ensuring that their Proposal is received in the City by the deadline. The City hereby provides notice to all Proposers of the imposition of a Cone of Silence for this solicitation, as set forth in Section 8A-7 of the City Code. “Cone of Silence," as used herein, means a prohibition on communication regarding a competitive solicitation such as a request for proposal, request for qualification, request for information or request/invitation for Proposal between a potential vendor, service provider, proposer or Proposer, or agent, representative, lobbyist or consultant for the potential Proposer; and (i) members of the City commission; (ii) the City's professional staff; or (iii) any member of the City's selection, evaluation or negotiation committee. Please contact the City Clerk and/or City Attorney with any qu estions on the Cone of Silence. Date Issued: December 18, 2024 2 of 92 520 South 'Miami THE CITY OF PLEASANT LIVING TABLE OF CONTENTS Section Page Section 1: Information for Proposers 4 Section 2: Terms and Conditions 14 Section 3. Scope of Services, Specifications, and Requirements 20 Section 4: Proposal Form Package 26 Attachments: Attachment A - Sample Agreement Attachment B – Declaration/Affidavit of Representation Attachment C – Janitorial Services Locations Matrix Attachment D – Photographs of Floor Types in Service Areas Attachment E – Background Screening, Chapter 435, Florida Statutes 435.04 3 of 92 521 SECTION 1. INFORMATION FOR PROPOSERS 1.1. INTRODUCTION/GENERAL BACKGROUND. The City of South Miami, Florida (the “City”) is soliciting proposals from qualified companies, firms, and individuals (“Proposers”) for JANITORIAL SERVICES, including all labor, materials, equipment, and all incidentals necessary, as set forth in Section 3 of this RFP (the “Services”). The City intends to award a contract to the most responsive and responsible Proposer whose Proposal is most advantageous to the City and which meets the requirements and criteria set forth in this RFP for the Services described in this RFP. 1.2. SCHEDULE OF EVENTS. The following schedule is anticipated for this RFP process, but is subject to change by the City, in its sole discretion, at any time during the RFP procurement process. No. Event Date* Time* (EST) 1 Advertisement/ Distribution of RFP December 18, 2024 4:00 PM 2 Pre-Proposal Conference NONE SCHEDULED 3 Deadline to Submit Questions / Requests for Clarification January 13, 2025 10:00 AM 4 City Issues Addenda and Responds to Questions January 17, 2025 10:00 AM 5 Deadline to Submit Sealed Proposals – Submission Deadline January 23, 2025 10:00 AM 6 Proposal Opening via Zoom at https://zoom.us/j/3056636339 January 23, 2025 10:30 AM 7 Evaluation of Proposals February 7, 2025 10:00 AM 8 City Manager issues recommendation to City Commission February 18, 2025 7:00 PM 9 Award Proposal(s) and Agreement(s) at City Commission Meeting February 18, 2025 7:00 PM 1.3. PROPOSAL DUE DATE. Sealed Proposals must submitted electronically through the DemandStar Electronic Proposal System at https://network.demandstar.com/. All sealed proposals must be received by 10:00 a.m. 4 of 92 522 — E.S.T. on January 23, 2025 (the “Submission Deadline”). Sealed proposals will be publicly opened through video conferencing using the Zoom platform on January 23, 2025 at 10:30 AM. Members of the public are invited to view the Proposal opening meeting through Zoom at https://zoom.us/j/3056636339 or by listening to the Proposal opening meeting on a dedicated phone line by dialing +1-786-635-1003 Meeting ID: 3056636339. 1.4. PRE-PROPOSAL CONFERENCE AND SITE(S) VISIT. A pre-proposal conference will NOT be held for this RFP. Prior to submitting a Proposal, each Proposer should be familiar with the City of South Miami’s facility conditions that may, in any manner, affect the Services to be performed by the awarded contractor or the equipment, materials and labor required. The Proposer is also required to examine carefully the Scope of Services set forth in Section 3 of this RFP and be thoroughly informed regarding any requirements or conditions that may in any manner affect the Services to be performed under the Agreement. No allowances will be made because of lack of knowledge of any conditions or requirements. 1.5. ADDENDA, CHANGES, OR REQUESTS FOR INTERPRETATION DURING PROPOSAL PROCESS. The City will not respond to oral inquiries or questions concerning this RFP. All written inquiries, requests for interpretation or clarification shall be sent to: Steven P. Kulick City of South Miami Chief Procurement Officer 6130 Sunset Drive City of South Miami, FL 33143 E-Mail: skulick@southmiamifl.gov Facsimile: (305)669-2636 Any written inquiry or request for interpretation or clarification must be sent by e-mail or written correspondence and received by the City no later than January 13, 2025 at 10:00 AM. All such interpretations or clarifications will be made in writing in the form of an Addendum to this RFP issued by the City to all known and/or registered prospective Proposers. Each prospective Proposer shall acknowledge receipt of such Addenda by including it in the Proposal Form. All Addenda shall be a part of this RFP and a part of the Agreement and each Proposer will be bound by such Addenda, whether or not received. It is the responsibility of each prospective Proposer to verify that it has received all Addenda issued before Proposal are submitted and opened. 1.6. SUBMISSION OF PROPOSAL. Sealed Proposals must submitted electronically through the DemandStar Electronic Proposal System at https://network.demandstar.com/ by the Submission Deadline and must be marked as “Proposal to City of South Miami, RFP No. FN2024-17 for Janitorial Services” and addressed to: Steven P. Kulick City of South Miami Chief Procurement Officer 5 of 92 523 6130 Sunset Drive City of South Miami, FL 33143 E-Mail: skulick@southmiamifl.gov THE RESPONSIBILITY FOR OBTAINING AND SUBMITTING A PROPOSAL TO THE CITY ON OR BEFORE THE SUBMISSION DEADLINE IS SOLELY AND STRICTLY THE RESPONSIBILITY OF THE PROPOSER. THE CITY IS NOT RESPONSIBLE FOR ANY DELAYS THAT MAY OCCUR DURING THE SUBMISSION OF PROPOSALS. ANY PROPOSAL RECEIVED AFTER THE SUBMISSION DEADLINE STATED IN THIS RFP WILL NOT BE OPENED AND WILL NOT BE CONSIDERED. FACSIMILE AND EMAILED PROPOSAL SHALL NOT BE CONSIDERED. The Proposal must be signed by an authorized officer of the Proposer who is legally authorized to bind the Proposer and enter into a contractual relationship in the name of the Proposer. The submittal of a Proposal by a Proposer will be considered by the City as constituting an offer by the Proposer to perform the required Services, upon the terms and at the prices stated by the Proposer. Proposals will be publicly opened and read. All Proposers and their representative may be invited to be present. Proposals shall be typed or printed in ink. All blanks on the Proposal form(s) must be completed. Names must be typed or printed below the signature. Proposals submitted by hand- delivery, facsimile and/or email will not be accepted. Only one (1) Proposal from any individual, firm, partnership, or corporation, under the same or different names, will be considered. If the City determines that any Proposer has interest in more than one (1) Proposal for Services contemplated; all Proposals in which such a Proposer is interested will be rejected. Proposer by submitting the Proposal certifies that the Proposal is made without previous understanding, contract, or connection with any person, firm or corporation making a Proposal for the same material, supplies, equipment or services and is in all respects, fair and without collusion of fraud. 1.7. PROPOSAL REQUIREMENTS & FORMAT. Each Proposer must present its products, services, and applicable features in a clear and concise manner that demonstrates the Proposer’s capabilities to satisfy the requirements of this RFP. The emphasis should be on accuracy, clarity, comprehensiveness, and ease of identifying pertinent information and suitability of the Services. Proposals MUST include the following in this order: 1.7.1. Executive Summary. Proposer must provide an executive summary of the Proposal that covers the following elements: 1.7.1.1. Cover Page. Each Proposal submitted shall have a cover page with the Proposer’s business name, address, and telephone number; name and all contact information for individual that will serve as the Project Manager (PM); the date and subject “Proposal to City of South Miami, RFP No. FN2024-17 for “Janitorial Services.” 1.7.1.2. Table of Contents. A Table of Contents that outlines in sequential order the major areas of the Proposal, including enclosures. All pages must be consecutively numbered and correspond to the Table of Contents and shall be in the order required by this RFP. 6 of 92 524 1.7.1.3. Letter of Interest. Letter describing the Proposer’s ability to meet the requirements of the RFP; commitment to the City; understanding of the Services to be performed, local conditions, and the City’s goals and objectives; the Proposer’s approach and philosophy in implementing the Services; and such other aspects of the Proposal. The Executive Summary must be single-spaced, 12-point font (regular typeface (e.g. Times New Roman, Arial, Calibri)), and shall not exceed three (3) pages in length. 1.7.2. Proposal Form Package. Proposer shall provide complete and accurate copies, with all required signatures and notarizations, for all the forms in the Proposal Package: Form 1. Proposal Form Package Acknowledgement. Form 2A. Proposer’s Certification (if Company or Corporation) Form 2B. Proposer’s Certification (if Partnership) Form 3. Single Execution Affidavits Form 4. Dispute Disclosure Form 5. Certification Regarding Debarment, Suspension, & Other Responsibility Matters Primary Covered Transactions Form 6. Proposer’s Qualifications Survey Form 7. Price Proposal Form Form 8. Reference List Form 9. Key Staff & Proposed Subcontractors 1.7.3. Proof of Experience. Provide documentation evidencing the experience of the Proposer and that the Proposer has successfully provided Services similar to those specified herein to other governmental entities, including municipalities of similar size and needs as the City. The Proposer firm shall be currently engaged in Services on a full-time basis and shall have been in existence and continuous operation providing the Services for a minimum of five (5) years. Proposer’s experience should demonstrate the Proposer’s: 1.7.3.1. Knowledge of the business operations and the legal requirements associated with the Services. 1.7.3.2. Experience and a strong background of performing similar janitorial services as the primary consultant and demonstrated experience with similar government organizations or agencies of similar size and scope as the City. The Respondent firm shall be currently engaged in the provision of the Services on a full-time basis and shall have been in existence and providing the Services for a minimum of ten (10) years, with a special preference for experience providing the Work in the State of Florida and especially South Florida. At least five (5) years of the Respondent firm’s experience shall be under its current business name. 1.7.4. Previous Projects. Respondent should demonstrate proof of completion for at least three (3) previously completed or ongoing janitorial services engagements within the past five (5) years, as identified in the list of recent contracts provided under Form 6. 1.7.5. Proposer's Qualifications. Include name, function, and qualifications of the Proposer’s firm and Project Manager. The Project Manager or contact assigned to the Services shall within the past three (3) years have conducted and been responsible for 7 of 92 525 providing Services in a similar project or environment. Please note, to receive further consideration, all Proposers must provide the necessary documentation to demonstrate that they meet the following minimum qualifications: 1.7.5.1. Service and Incorporation. Contractor shall have been in business and continuous operation and service and incorporated in the State of Florida for a minimum of five (5) years. 1.7.5.2. Licenses. Contractor must be fully licensed with any and all applicable and required licenses, certifications and permits for Services, including government licenses, certifications, and permits from the State of Florida, Miami-Dade County, the City, and any other governing governmental regulatory authorities or sports associations. 1.7.6. Personnel Qualifications/Key Staff. The Proposer must include the following information for this requirement: 1.7.6.1. Key Staff. Complete and submit Form 9, Key Staff and Proposed Subcontractors. Include a one-page resume with contact information for each Key Staff members. Resumes should include experience with similar services, specifying the role the individual employee served in the provision of the Services. 1.7.6.2. Organizational Chart. Provide an organizational chart showing reporting structure for all Key Staff, including any key subcontractors. 1.7.7. Insurance Certificates. Proposer shall provide certificates of insurance demonstrating compliance with the requirements set forth under Section 2 of this solicitation, including: 1.7.7.1. Commercial General Liability 1.7.7.2. Workers Compensation & Employer’s Liability 1.7.7.3. Business Automobile Liability THE CITY MAY REQUIRE HIGHER LIMITS OF INSURANCE OR ADDITIONAL COVERAGE IF DEEMED NECESSARY. 1.7.8. Additional Information. Proposer may provide any additional information that highlights the Proposer’s experience, awards, or expertise that is relevant and directly applicable to this RFP. Additional information must not exceed two (2) pages, single- spaced and in 12-point font (regular typeface). 8 of 92 526 1.8. EVALUATION CRITERIA. Award shall be made to the Responsible Proposer(s) whose Proposal is determined to be the lowest, most responsive Proposal that is most advantageous to the City. Proposals will be evaluated according to the following criteria and respective weight: Category Criteria Maximum Points 1. Qualifications: Competency and technical expertise of the firm and personnel to perform the services in accordance with the Scope of Services. 30 2. Experience: Past and/or current experience; including related government experience of similar scope and size. 25 3. References: References/good standing with previous clients 30 4. Proposed Pricing 15 TOTAL 100 1.9. SELECTION PROCESS The City shall evaluate responses received by the submission deadline in accordance with the evaluation procedures outlined below. 1.9.1. Phase I. Staff Level Review for Compliance with Minimum Requirements. A member of City Staff shall review and evaluate the Responses submitted to ensure the minimum requirements of the RFP have been met. The City Manager or designee may reject those Responses that do not meet the minimum requirements of the RFP. 1.9.2. Phase II. Evaluation Selection Committee Review. The City Manager will appoint an Evaluation Selection Committee (“Committee”) to review and evaluate the responsive Proposals during a public meeting (the City will provide instructions on how to participate and access the meeting). The Committee shall select in order of preference and rank the firm(s) it deems to be qualified to perform the required services using the evaluation criteria set forth above. The highest ranked three (3) Proposers will be short-listed and may be called for oral presentations b efore the Committee as further detailed under Section 1.9.3 herein. The City reserves the right to short-list additional Proposers for oral presentations before the Committee. The Committee reserves the right to request additional information or seek clarifications as it deems necessary. Failure to comply with any mandatory requirements may disqualify 9 of 92 527 a response. The Committee reserves the right to conduct additional interviews or require presentations prior to finally ranking the Proposers. 1.9.3. Phase III. Oral Presentations (if Required by Committee). The Committee may call the short-listed Proposers for oral presentations before the Committee regarding their Proposal, approach to the Services, and ability to furnish the required Services. All short-listed Proposers and subconsultants in their teams shall be present at the assigned time for a 20-minute presentation followed by up to a 10-minute question-and-answer session. The Proposers are encouraged to be represented only by the Project Manager and the staff identified in the Response. Additional details on the oral presentations may be provided to the short-listed Proposers. The City will notify the Proposers where the oral presentations, if any, will be conducted and whether the Proposers may appear virtually or must appear in-person. If oral presentations are requested by the Committee, the oral presentation will be worth a maximum of 25 additional points and shall be added to the Evaluation Committees Final Scoring for each Proposer. The City will notify the Proposers where the oral presentations, if any, will be conducted and whether the Proposers may appear virtually or must appear in-person. The Committee shall rank the Proposers and provide its written recommendations to the City Manager. 1.9.4. Phase IV. Recommendation to City Commission. After short-listing of the top three Proposers deemed to be responsible by the Evaluation Committee, the City Manager will present a recommendation to the City Commission with the Evaluation Committee’s rankings and recommendations for consideration by the City Commission and the City Manager’s recommendation for award or rejection of all proposals for approval at a Commission meeting. 1.9.5. Phase V. City Commission Meeting to Select and Award Agreement to Responsible Proposer(s). Upon receipt of the City Manager’s recommendation for award, the City Commission may select the Proposal of the Responsible Proposer(s) that it determines is the most responsive Proposal that is most advantageous to the City, taking into consideration all aspects of the Proposer’s Proposal and authorize the City Manager to execute a professional services agreement with the selected Proposer(s). The City Commission shall have the final authority to select the Proposer(s) and award any Professional Services Agreement(s). Should the Committee’s evaluation process result in a tie in the rankings, the tie will be resolved in favor of the Proposer with the greatest number of years in existence providing the Services. If the Proposer’s both have the same number of years in existence providing the Services, the tie shall be resolved in favor of the Proposer with the Project Manager with the most years of experience providing the Services. If a tie remains after evaluating the firm and the Project Manager’s years of experience providing the Services, the tie will be resolved by lot. 1.10. CITY’S RIGHTS; WAIVER OF IRREGULARITIES. The City reserves the right to reject any or all proposals which is in any way incomplete or irregular, reissue the entire solicitation, or enter into contracts with more than one Contractor. 10 of 92 528 The City reserves the right to accept or reject any and/or all Proposal(s) or parts of a Proposal, to workshop or negotiate any and all Proposal(s), to select and award Proposer(s) for all or any of the Services, waive irregularities in Proposal, to cancel or discontinue this RFP process, and to request new Proposal(s) for the required Services. The City Commission shall make the final determination and award of Proposal(s). All materials submitted in response to this Request for Proposals become the property of the City and will be returned only at the option of the City. The City has the right to use any or all ideas presented in any Proposal or responses to the RFP, whether amended or not, and selection or rejection of Proposal does not affect this right. 1.11. CODE OF ETHICS PROVISIONS. 1.11.1. Cone of Silence. The provisions of City’s Cone of Silence are applicable to this RFP. The City’s Cone of Silence provisions can be found under Section 8A-7 of the City Code of Ordinances. Questions regarding the Cone of Silence may be sent to: Nkenga “Nikki” Payne, CMC, FCRM City Clerk City of South Miami 6130 Sunset Drive South Miami, Florida 33143 Npayne@southmiamifl.gov The Cone of Silence as used herein means a prohibition of any communication regarding a competitive solicitation such as a request for proposal, request for qualification, request for information or invitation/request for Proposal, between a potential vendor, service provider, proposer or Proposer (hereinafter referred to as the "potential Proposer"), or agent, representative, lobbyist or consultant for the potential Proposer; (hereinafter referred to as the "Proposer's representative"); and (i) Members of the City Commission; or (ii) City's professional staff; or (iii)Any member of the City's selection, evaluation or negotiation committee. The provisions of the Cone of Silence shall not apply to: (i) Communications at a duly noticed pre-Proposal conferences or at any duly noticed public selection or negotiation committee meeting or duly noticed public City commission meeting at which the City Manager has placed the subject of the solicitation on the agenda; (ii) Communication regarding the solicitation at recorded contract negotiations, recorded oral presentation or recorded oral question and answer session and recorded contract negotiation strategy sessions in compliance with the exemption in F.S. § 286.0113; (iii)Written communication at any time with any City professional staff (not including selection, evaluation or negotiation committee members), unless specifically prohibited by the applicable competitive solicitation documents. This section shall not be construed to prevent written communication between City professional staff and any 11 of 92 529 City selection, evaluation or negotiation committee. A copy of any written communication made during the cone of silence shall be contemporaneously filed with the City clerk by the potential Proposer or Proposer's representative. The City clerk shall make copies available to any person upon request; (iv) Communication that is strictly limited to matters of those processes or procedures that are contained in the corresponding solicitation document and which communication is between any person and the City's purchasing agent or the City employee who is designated as being responsible for administering the procurement process for such solicitation; (v) Communications with the City attorney and his or her staff; (vi) Communications during any duly noticed site visits to determine the competency and responsibleness of Proposers regarding a particular Proposal during the time period between the opening of proposals and the time the City Manager makes a written recommendation; (vii) Any emergency procurement of goods or services pursuant to City code; (viii) Responses to a request made by the City's purchasing agent, or the City employee who is designated as being responsible for administering the procurement process for such solicitation, for clarification or additional information; (ix) Communications prior to Proposal opening between City's professional staff and potential Proposers and/or Proposer's representatives to enable City staff to seek and obtain industry comment or perform market research, provided all communications related thereto between a potential Proposers and/or Proposer's representatives and any member of the City's professional staff including, but not limited to the City Manager and his or her staff, are in writing or are made at a duly noticed public meeting. 1.11.2. Lobbying Prohibited. All potential Proposers and their agents who intend to submit, or who submitted, a Proposal or response to this solicitation, are prohibited from lobbying, individually or collectively, any City Commissioner, candidate for City Commissioner, or any employee of the City in connection with this solicitation. The term "Lobbyist" means all persons (including officers and managers of a legal entity), firms, or legal entities such as a corporation, partnership or limited liability company, employed or retained by a principal (including an officer of the principal or an employee of the principal whose duties include marketing, or soliciting business, for the principal) who seeks to encourage the passage, defeat, or modifications of (1) ordinance, resolution, action or decision of the City Commission; (2) any action, decision, recommendation of the City Manager or any City board or committee; or (3) any action, decision or recommendation of City personnel during the time period of the entire decision-making process on such action, decision or recommendation which foreseeably will be heard or reviewed by the City Commission, or a City board or committee. Contact may only be made through regularly scheduled Commission meetings, or meetings scheduled through the Procurement Division, which is for the purpose of 12 of 92 530 obtaining additional or clarifying information or as otherwise provided for in the City’s Cone of Silence. Any presentation before a selection committee is considered to be lobbying; however, the presentation team may avoid formal registration by complying with section 8A-5(c)(9), of the City Code of Ordinances and completing Attachment B to this RFP. Any person who submits a proposal, whether solicited or unsolicited, on behalf of his or her principal or his or her employer is considered to be a lobbyist and must register. An officer or manager of a legal entity who is submitting a proposal, whether solicited or unsolicited, is considered to be a lobbyist. All Proposers are strongly encouraged to review Section 8A-5 of the City Code of Ordinances for further information. To register as a lobbyist, please contact the City Clerk at: Nkenga “Nikki” Payne, CMC, FCRM City Clerk City of South Miami 6130 Sunset Drive South Miami, Florida 33143 Npayne@southmiamifl.gov 13 of 92 531 SECTION 2. TERMS AND CONDITIONS 2.1. PURPOSE OF PROPOSAL. The City requests Proposals from qualified firms (“Proposers”) for Janitorial Services (the “Services”). 2.2. EQUIPMENT. Any equipment or products used by Contractor to provide Services pursuant to this RFP shall remain the property of the Contractor. In the event equipment or products used by the Contractor are found to be defective, of unsatisfactory quality, or do not conform to the requirements of this RFP or the Specifications, the City reserves the right to reject the equipment or product(s), at the Contractor’s expense. 2.3. PRICING. The Proposal form attached to this RFP under Section 4, Form 7 and to be included with each Proposal shall specify the Proposer’s pricing and/or fees for the equipment and Services requested herein. Proposer should include any and all applicable taxes in Proposal prices. If the Proposer is awarded an Agreement pursuant to this RFP, the prices and fees quoted in the Proposal shall remain fixed and firm during the term of the Agreement. 2.4. PROPOSAL COSTS. Proposers submitting Proposal do so entirely at their own cost and expense. There is no expressed or implied obligation by the City to reimburse any individual or firm for any costs or expenses incurred in preparing or submitting Proposal, providing additional information when requested by the City, or for participating in any selection interviews. 2.5. LICENSES AND PERMITS. Proposer shall secure any and all necessary and required licenses, certifications and permits to conduct the Services, including, but not limited to, all Federal, State, County and City licenses and permits. All Proposers must provide the necessary documentation to demonstrate that they meet all applicable licensing and permitting requirements. By submitting a Proposal in response to this RFP, Proposer represents and warrants to the City that it holds all licenses, certifications and permits (“Licenses”) required by applicable law and by any other governmental authority or agency to perform the Services. Proposer represents and warrants to the City that the Licenses shall be in full force and effect on the date of performance of the Services and further represents that it holds and will hold all Licenses throughout the term of the Agreement. Proposer shall provide the City with copies of all Licenses and any additional permits that may be required for performance of the Services with its Proposal and during the term of the Agreement. Where the Contractor is required to enter onto City property, public rights-of-way or other property to deliver equipment or to perform the Services as a result of a Proposal award, the Contractor will assume the full duty, obligation and expense of obtaining all necessary approvals, licenses, 14 of 92 532 permits, inspections and insurance required. The Contractor shall be liable for any damages or loss to the City property, or other property or persons, occasioned by the acts or omissions, or the negligence of the Proposer (or their agent) or any person the Proposer has designated in the performance of the Services, as a result of the Proposal. 2.6. INSURANCE. 2.6.1. If selected, the Contractor shall secure and maintain throughout the duration of the awarded contract insurance of such types and in such amounts not less than those specified below as satisfactory to City, naming the City as an Additional Insured, underwritten by a firm rated A-X or better by A.M. Best and qualified to do business in the State of Florida. The insurance coverage shall be primary insurance with respect to the City, its officials, employees, agents and volunteers naming the City as additional insured. Any insurance maintained by the City shall be in excess of the Contractor’s insurance and shall not contribute to the Contractor’s insurance. The insurance coverages shall include at a minimum the amounts set forth in this section and may be increased by the City as it deems necessary or prudent. Copies of Contractor’s actual Insurance Policies as required herein and Certificates of Insurance shall be provided to the City, reflecting the City as an Additional Insured. Each Policy and certificate shall include no less than (30) thirty-day advance written notice to City prior to cancellation, termination, or material alteration of said policies or insurance. All coverage forms must be primary and non-contributory and the Contractor shall provide a waiver of subrogation for the benefit of the City. The Contractor shall be responsible for assuring that the insurance policies and certificates required by this Section remain in full force and effect for the duration of the Services. 2.6.1.1. Commercial General Liability coverage with limits of liability of not less than a $1,000,000 per Occurrence combined single limit for Bodily Injury and Property Damage. This Liability Insurance shall also include Completed Operations and Product Liability coverages and eliminate the exclusion with respect to property under the care, custody and control of Contractor. The General Aggregate Liability limit and the Products/Completed Operations Liability Aggregate limit shall be in the amount of $2,000,000 each. 2.6.1.2. Workers Compensation and Employer’s Liability insurance, to apply for all employees for statutory limits as required by applicable State and Federal laws. The policy(ies) must include Employer’s Liability with minimum limits of $1,000,000.00 each accident. No employee, subcontractor or agent of the Contractor shall be allowed to provide Services pursuant to this RFP who is not covered by Worker’s Compensation insurance. 2.6.1.3. Business Automobile Liability with minimum limits of $1,000,000.00 per Occurrence, combined single limit for Bodily Injury and Property Damage. Coverage must be afforded on a form no more restrictive than the latest edition of the Business Automobile Liability policy, without restrictive endorsements, as filed by the Insurance Service Office, and must include Owned, Hired, and Non-Owned Vehicles. 2.6.2. The Contractor agrees to indemnify, defend and hold harmless the City from and against any and all claims, suits, judgments, losses, damages, executions and/or liabilities as to bodily injuries and/or property damage which arise or grow out of the Agreement or Contractor’s performance of the Services required by this RFP. 15 of 92 533 2.6.3. The Contractor shall also, upon request by the City, provide copies of all official receipts and endorsements as verification of Contractor's timely payment of each insurance policy premium as required by the Agreement. THE CITY MAY REQUIRE HIGHER LIMITS OF INSURANCE OR ADDITIONAL COVERAGE IF DEEMED NECESSARY. 2.7. [INTENTIONALLY OMITTED] 2.8. PROPOSAL GUARANTY/PROPOSAL BOND. Each Proposal must be accompanied by a Proposal Bond or Cashier’s Check, in the amount of five percent (5%) of the Proposal, in the form provided in Form 10. The Proposal Guaranty shall be made by certified or cashier's check or by a Proposal bond made payable to the City and provided by a surety company authorized to do business as a surety in the state. All Proposal Bonds shall be valid for a period of at least 90 days from the Proposal submission date. The Proposal Bonds for all unsuccessful proposals shall be returned after the 90-day period. The purpose of the Proposal bond is to ensure that proposals are honored and that they remain valid for the required period. Accordingly, Proposal bonds are subject to forfeiture any time Proposers refuse to honor their proposals for at least 90 days after Proposal opening. The Proposal Guaranty of the successful Proposer will be retained until such Proposer has executed a contract and furnished any payment and performance bonds, along with all insurance policies, licenses, or other documentation that may be required by the City. If the successful Proposer fails to furnish the required payment and performance bonds, fails to execute and deliver the contract, or fails to deliver the required insurance policies, licenses, or other documentation to the office of the purchasing agent within the time specified in the instructions to Proposers, the City may annul the notice of award and the entire sum of the Proposal Guaranty shall be forfeited to the City. All Proposal Guarantees of unsuccessful Proposers will be returned after the Contract is awarded and executed. If the requirement for a Proposal Guaranty/Proposal Bond is waived, the City shall select this box:☒. 2.9. COMPLIANCE WITH LAW AND OTHER REQUIREMENTS. Contractor shall conduct its operations in compliance with all applicable federal, State, County and City laws and regulations in providing the Services required by this RFP. 2.10. ASSIGNMENT. The Contractor shall not transfer or assign the performance of the Services required by this RFP and the Agreement without the City’s prior written consent. Any award issued pursuant to this RFP and monies which may be payable by the City, are not assignable except with the City’s prior written approval. 2.11. ATTORNEY’S FEES. If the City incurs any expense in enforcing the terms of the Agreement, whether suit be brought or not, Contractor agrees to pay all such costs and expenses including, but not limited to, court costs, interest and reasonable attorney’s fees. 2.12. CONTRACTOR’S RELATION TO THE CITY. 16 of 92 534 It is expressly agreed and understood that the Contractor is in all respects an independent contractor as to all Services hereunder, and that the Contractor is in no respect an agent, servant or employee of the City. This RFP specifies the Services to be performed by the Contractor, but the method to be employed to accomplish the Services shall be the responsibility of the Contractor, unless otherwise provided in the Agreement or by the City. 2.13. DISCRIMINATORY PRACTICES. The Contractor shall not discriminate or deny service, deny access, or deny employment to any person on the basis of race, color, creed, sex, sexual orientation, religion or national origin. The Contractor will strictly adhere to the equal employment opportunity requirements and any applicable requirements established by the State of Florida or the Federal Government. 2.14. CANCELLATION. Failure on the part of the Contractor to comply with the conditions, specifications, requirements and terms as determined by the City, shall be just cause for cancellation of the award, with the Contractor holding the City harmless. 2.15. INDEMNIFICATION. The Contractor shall indemnify, save harmless and defend the City, its officers, agents and employees from and against any claims, demands or causes of action of whatsoever kind or nature arising out of any act, error, omission, negligent act, conduct or misconduct of the Contractor, its agents, servants or employees, in the performance of the Services pursuant to this RFP and/or from any procurement decision of the City including without limitation, awarding the Agreement to a Contractor. 2.16. MULTIPLE /OTHER VENDORS. The City reserves the right to select and award multiple Proposers to provide one, some or all of the Services. If the selected contractors are unavailable, the City reserves the right to seek and obtain other sources. 2.17. PUBLIC ENTITY CRIME/DISQUALIFICATION. Pursuant to Section 287.133(3)(a), Florida Statute, all Proposers are advised as follows: “A person or affiliate who has been placed on the convicted vendor list following a conviction for a public entity crime may not submit a Proposal on a contract to provide any goods or services to a public entity, may not submit a Proposal on a contract with a public entity for the construction or repair of a public building or public work, may not submit proposals on leases of real property to a public entity, may not be awarded or perform work as a contractor, supplier, subcontractor, or consultant under a contract with any public entity, and may not transact business with any public entity and may not transact business with any public entity in excess of the threshold amount provided in s.287.017 for CATEGORY TWO for a period of 36 months from the date of being placed on the convicted vendor list.” 2.18. NO CONTINGENCY FEE. 17 of 92 535 Proposer shall warrant that it has not employed or retained any company or person, other than a bona fide employee working solely for the Proposer, to solicit or secure the Agreement and that it has not paid or agreed to pay any person, company, corporation, individual or firm, other than a bona fide employee working solely for the Proposer, any fee, commission, percentage, gift or other consideration contingent upon or resulting from the award or making the Agreement. For the breach or violation of this provision, the City shall have the right to terminate the Agreement, without liability, at its discretion. 2.19. PUBLIC RECORDS; CONFIDENTIALITY. Proposers are hereby notified that all information submitted as part of or in support of Proposal submitted pursuant to this RFP are public records subject to public disclosure in accordance with Chapter 119, Florida Statutes. If there is any apparent conflict between Florida’s Public Records Law and this RFP, Florida Law will govern and prevail. All Proposals submitted in response to this RFP shall become the property of the City. Unless the information submitted is proprietary, copyrighted, trademarked, or patented, the City reserves the right to utilize any or all information, ideas, conceptions, or portions of any Proposal in its best interest. Acceptance or rejection of any Proposal shall not nullify the City’s rights hereunder. Notice Pursuant to Section 119.0701(2)(a), Florida Statutes. IF THE PROPOSER HAS QUESTIONS REGARDING THE APPLICATION OF CHAPTER 119, FLORIDA STATUTES, TO THE PROPOSER’S DUTY TO PROVIDE PUBLIC RECORDS RELATING TO THIS SOLICITATION, CONTACT THE CUSTODIAN OF PUBLIC RECORDS: Custodian of Records: Nkenga “Nikki” Payne, CMC, FCRM Mailing address: 6130 Sunset Drive South Miami, FL 33143 Telephone number: 305-663-6340 Email: NPayne@southmiamifl.gov 2.20. AMERICAN RESCUE PLAN ACT PROVISIONS. Proposer acknowledges that the Services may be fully or partially funded utilizing Coronavirus State and Local Fiscal Recovery Funds allocated to the City pursuant to the American Rescue Plan Act (“ARPA”). The selected Contractor shall be required to comply with all laws, rules, regulations, policies, and guidelines (including any subsequent amendments to such laws, regulations, policies, and guidelines) required by ARPA, as further detailed in the ARPA Addendum to this solicitation. If compliance with this section is required, the City shall select this box: . 2.21. GRANT FUNDING. By submitting a response to this solicitation, Proposers acknowledge that the Services may be fully or partially funded utilizing funds from the grants listed below (the “Grant”). Accordingly, by submitting a response to this competitive solicitation, the Proposer warrants and represents that it has reviewed the terms and conditions for each Grant and will perform the Services in accordance with the terms and conditions of the Grant(s). 18 of 92 536 Grant Title Grant Agreement Attachment No. If the Services will be funded utilizing Grant funds, the City shall select this box:. END OF SECTION 2 19 of 92 537 SECTION 3. SCOPE OF SERVICES, SPECIFICATIONS, AND REQUIREMENTS 3.1 General Requirements: The City of South Miami is seeking proposals from experienced and capable parties to provide janitorial services for all City facilities and buildings. The Contractor must furnish all material, labor, supplies and equipment necessary to perform all operations in connection with daily janitorial services for the City of South Miami. The term of this agreement will be for a period of three-years (3), with one (1) two-year (2) Option- to-Renew from the date of execution of the agreement between the City and Contractor at the discretion of the City Manager. 3.2 Site Specifications and Location: Please refer to Attachment C, “Janitorial Service Locations Matrix,” and Attachment D, “Photographs of Floor Types in Service Areas,” for details of each facility identified for this project; including estimated Square Feet, Restrooms, Appliances, Sinks and Counters, Windows and Water Fountains. City facilities and addresses are described as: a) Sylva Martin and Porch; City Hall (1st & 2nd Floor); Commission Chambers, Police Department (1st & 2nd Floor) – 6130 Sunset Drive, South Miami, Fl 33143 o Service Hours: ▪ Sylva Martin Bldg; City Hall (1st & 2nd Floor) Commission Chambers (twice on Commission Meeting Days: • Monday – Friday: 6 PM to 10 PM ▪ Police (1st & 2nd Floor): • Monday – Friday: 7 AM to 4 PM b) Community Center (Multi-Purpose, Arts & Crafts Computer Lab & Education Room)– 5800 SW 66 Street, South Miami, FL 33143 o Service Hours: ▪ Monday – Friday 6 AM to 12 PM c) Indoor Basketball Gymnasium - 5800 SW 66 Street, South Miami, FL 33143 o Service Hours: ▪ Monday – Friday 6 AM to 12 PM d) Marshall Williamson building, commonly known as Mobley building – 5825 Southwest 68th Street, South Miami, FL 33143 20 of 92 538 o Service Hours: ▪ Monday – Friday 12 PM to 4 PM e) Senior Citizens Center – 6701 SW 62 Avenue, South Miami, Fl 33143 o Service Hours: ▪ Monday – Friday 12:30 to 4 PM f) Public Works & Motor Pool - 4795 SW 75 Avenue, Miami, Fl 33155 o Service Hours: ▪ Monday – Friday 7 AM to 4 PM g) Dante Fascell Park – 8600 SW 57 Avenue, Miami 33143 (Current Restroom – Office Facility. o Service Hours: ▪ Monday – Friday 6:00 AM to 7:30 AM 3.3 Responsibilities of the Parties: The Contractor must perform all duties and provide the required material, labor, supplies and equipment as identified below: a) OFFICES-Daily Service 1. Empty all waste receptacles, removing waste to designated area for disposal, and replace plastic liners 2. Empty and damp wipe garbage receptacles, 3. Dust and spot clean all desktops and counter tops. 4. Dust all horizontal surfaces of desks, chairs, tables and office equipment. 5. Dust all exposed filing cabinets, bookcases and shelves. 6. Dust all horizontal surfaces of equipment, ledges, and sills, shelves, ventilating louvers, frames, partitions, etc. 7. Clean and sanitize all drink fountains. 8. Remove cobwebs from walls and ceilings. 9. Spot wash glass surfaces (including windows), doors, frames, kick and push plates, handles, light switches, baseboards, and similar surfaces. All surfaces will be cleaned with the utmost care. 10. Vacuum clean all exposed carpeting. 21 of 92 539 11. Inspect carpet for spots and stains, remove where possible. 12. Dust mop or sweep all non-carpeted floors thoroughly using a chemically treated mop. 13. Mop uncarpeted floors as needed, minimum 3 times per week. 14. Spot clean spills with a damp mop. 15. Before leaving any office, shut off lights, electrical appliances, and shut door(s) 16. Remove fingerprints and smudges from all walls. 17. Report all burned out lights. 18. Detail and clean all kitchen, counter tops, or lunchroom areas, where applicable 19. Clean Stairs daily, where applicable. 20. Clean/Wipe Down Office Desks b) Community Center (Muli-Purpose, Arts & Crafts, Computer Lab & Educations Room: DAILY SERVICE: 1. Sweep & Mop 2. Empty Trash Receptacles c) Indoor Basketball Gymnasium: 1. Sweep all areas: DAILY 2. Mats Vacuumed: DAILY 3. Bleachers swept and wiped down: Once per Week 4. Basketball backboards squeegeed: Once per Week d) OFFICES-Weekly Service 1. Dust all ledges, wall moldings, pictures, shelves, and other surfaces above [hand height]. 2. Brush down and clean all vents and grills 3. Clean all baseboards. 4. Dust all light fixtures and covers. 5. Clean all ground level windows and glass partitions e) OFFICES-Monthly Service (Community Center Only) 22 of 92 540 1. Wax and buff floors. f) OFFICES-Quarterly Service 1. Dust and clean or vacuum all drapes and blinds. 2. Detail and vacuum chairs and upholstered furniture. 3. Dust and clean all light fixtures and covers. 4. Scrub and wax vinyl floors. g) BI-ANNUAL SERVICE Deep cleaning, all carpets at all City facilities. Thoroughly clean all outside windows and glass partitions. This may also include additional request for service during this cleaning session. (Stain removal etc.) h) RESTROOMS-Daily Service 1. Empty trash containers and remove trash to designated area. 2. Damp wipe or scrub and sanitize all trash containers. 3. All Commodes, urinals, and basins to be scoured and disinfected. Both sides of toilet seat to be cleaned daily. 4. Clean and polish all faucets, sinks, and exposed metal. 5. All piping to be cleaned and polished. 6. All partitions to be spot cleaned and washed as necessary. 7. Replenish all paper products, including toilet covers, paper towels and toilet paper daily. 8. Replenish hand soap daily. 9. Sweep tile floors and damp mop with germicidal disinfectant. i) RESTROOMS-Weekly Service 1. Wash down all walls and sanitize all partitions. 2. Wash all waste containers and disinfect. 3. Clean and polish all doors, doorplates, and hardware. 4. All floors cleaned and grout cleaned. 5. Clean showers. j) RESTROOMS-Monthly Service 23 of 92 541 1. Wipe clean all ceilings, lights, and fixtures. 2. Detail all toilet compartments and fixtures. 3. Brush and clean grills and vents. 4. Clean shower curtains and shower heads. 5. Clean wall tile(s) k) RESTROOMS-Quarterly Service 1. Scrub all tile floors. l) EMERGENCY SERVICE – As Needed: The Contractor must provide an Emergency “After-Hours/Weekends/Holidays” contact for emergency janitorial services that may occur in any of the City facilities and buildings. The City will contact the Contractor and advise the nature of the emergency services that are required. After inspection, the Contractor will provide a quotation to the head of the Public Works Department or designee for the emergency services. Emergency services are additional and are not included in Daily, Weekly, Monthly, Quarterly or Bi-Annual services and they include but not be limited to; Electrostatic Disinfecting Services using EPA (Environmental Protection Agency) approved current disinfectants listing: “List N: Products with Emerging Viral Pathogens and Human Coronavirus Claims for use Against SARS -CoV-2; in accordance with www.epa.gov/pesticide-registration/list-n-disinfectnats-use-against-sars- cov2 The Contractor must respond to the City within two (2) hours from receiving the Emergency call from the City. The City will provide the Contractor and their qualified personnel access to all City facilities and janitorial storage areas during the hours of services, or as agreed, to perform janitorial services. 3.4 Background Screening: All selected Contractor’s personnel providing service at City facilities must be in compliance with Level II Background Screening and fingerprinting requirements as per Attachment E Chapter 435, including but not limited to Florida Statute 435.04, Employment Screening, prior to the scheduled start date of janitorial services. The Contractor is responsible for the Background Screenings and, all completed Background Screenings must be approved by the City of South Miami Police Department prior to the scheduled start date for janitorial services and prior to the start of any employees not previously screened. 3.5 Qualifications: The selected Respondent and/or its subcontractors (as applicable) must have: 24 of 92 18,249 542 1. a minimum of five (5) years prior experience in commercial janitorial services. 2. knowledge of business operations and the legal requirements associated with this type of operation 3. Demonstrated financial ability to perform the responsibilities of the Agreement 4. Three professional references, including contracts/firms currently servicing. 5. Background information on persons of significant responsibility within the proposer’s organization. 3.6 Janitorial Services Locations (6 Buildings, 4 Locations) NOTE: Refer to Attachment C, “Janitorial Service Locations Matrix,” and Attachment D, “Photographs of Floor Types in Service Areas” for a detailed description of the City facilities included with this project, including estimated square footage, restrooms, appliances, sinks and counters, water fountains, etc. NOTE: A BID BOND IS NOT REQUIRED FOR THIS PROJECT END OF SECTION 3 25 of 92 543 SECTION 4 PROPOSAL FORM PACKAGE As provided in the RFP, the following items must be attached to this Proposal: FORMS STATUS Form 1 – Proposal Form Package Acknowledgement ❑ Form 2A. Proposer’s Certification (if Company or Corporation) ❑ Form 2B. Proposer’s Certification (if Partnership) ❑ Form 3. Single Execution Affidavits ❑ Form 4. Dispute Disclosure ❑ Form 5. Certification Regarding Debarment, Suspension, & Other Responsibility Matters Primary Covered Transactions ❑ Form 6. Proposer’s Qualifications Survey ❑ Form 7. Price Proposal Form ❑ Form 8. Reference List ❑ Form 9. Key Staff & Proposed Subcontractors ❑ ATTACHMENTS This competitive solicitation incorporates the following attachments, which should be reviewed thoroughly and, if applicable, completed prior to submitting a response to this competitive solicitation. The City is attaching the following Attachments: Attachment A. Sample of Professional Services Agreement Attachment B. Declaration/Affidavit of Representation Attachment C. Janitorial Services Locations Matrix Attachment D. Photographs of Floor Types in Service Areas Attachment E. Background Screening, Chapter 435, Florida Statutes 435.04 26 of 92 544 FORM 1 PROPOSAL FORM PACKAGE ACKNOWLEDGEMENTS I hereby propose to furnish the goods and services specified in the Request for Proposals, RFP No. FN2024-17. I agree that my Proposal will remain firm for a period of 180 days after opened by the City in order to allow the City adequate time to evaluate the Proposal. I certify that all information contained in this Proposal is truthful to the best of my knowledge and belief. I further certify that I am duly authorized to submit this Proposal on behalf of the Firm named as the Proposing Firm and that said Firm is ready, willing, and able to perform if awarded the Agreement. I further certify, under oath, that this Proposal is made without prior understanding, agreement, connection, discussion, or collusion with any other person, firm or corporation submitting a Proposal; no officer, employee or agent of the City of South Miami or any other Proposer has an interest in said Proposal. Furthermore, I certify that the undersigned executed this Proposal Form with full knowledge and understanding of matters therein contained and was duly authorized. I further certify that the Proposer acknowledges receipt of all Addenda issued by the City in connection with the RFP (Check the box next to each addendum received). ______ Addendum 1 Addendum 6 ______ Addendum 2 Addendum 7 ______ Addendum 3 Addendum 8 ______ Addendum 4 Addendum 9 _______ Addendum 5 Addendum 10 Attached hereto are the following forms/documents which form a part of this Proposal: Form 1. Proposal Form Package Acknowledgement. Form 2A. Proposer’s Certification (if Company or Corporation) Form 2B. Proposer’s Certification (if Partnership) Form 3. Single Execution Affidavits Form 4. Dispute Disclosure Form 5. Certification Regarding Debarment, Suspension, & Other Responsibility Matters Primary Covered Transactions Form 6. Proposer’s Qualifications Survey Form 7. Price Proposal Form Form 8. Reference List Form 9. Key Staff & Proposed Subcontractors 27 of 92 545 546 FORM 1 PROPOSAL FORM PACKAGE ACKNOWLEDGEMENTS (CONTINUED) NAME OF PROPOSER FIRM NAME &TITLE,TYPED OR PRINTED MAILING ADDRESS ...7 /J ^W',' (^X)‘K#’ TELEPHONE NUMBER State of Florida County of WL ft fU, The foregoing instrument was acknowledged before me by means of physical presence or _ online notarization,this day of .2QTS.bv^Vft^CAkULO (name of person)as (type of authority)for Starr(p.or Type as .OFF'-: GUSTAVO A.HERRERA MY COMMISSION #HH 423473 EXPIRES:July 31,2027 Notary Public (] Commissioned) of party on behalf of whom instrument is executed). /"Personally known to me:or Yz Produced identification (Type of Identification: z ) Did take an oath;or Did not take an oath 28 of 92 FORM 2A PROPOSER’S CERTIFICATION (if Company or Corporation) CERTIFICATE STATE OF _____________ ) ) SS COUNTY OF ___________ ) I HEREBY CERTIFY that a meeting of the Board of Directors of ___________________________________________________________________ a corporation or company existing under the laws of the State of _________________________, held on ______________________, 2023, the following resolution was duly passed and adopted: RESOLVED, that, as _____________of the Corporation/Company, be and is hereby authorized to execute the Proposal dated, __________, 2024 to the City of South Miami for RFP No. FN2024-17 “Janitorial Services,” and that this execution thereof, attested by the Secretary of the Corporation/Company, and with the Corporate/Company Seal affixed, shall be the official act and deed of this Corporation/Company. I further certify that said resolution is now in full force and effect. IN WITNESS WHEREOF, I have hereunto set my hand and affixed the official seal of corporation/company on this the _____________ of ___________, 2024. _______________________ Secretary (SEAL) 29 of 92 J.Perez Enterprises, Inc. D/B/A High Maintenance Services FLORIDA 01/22/2025 01/22/2025 01/23/2025 23 01/2025 547 FORM 2B PROPOSER’S CERTIFICATION (if Partnership) CERTIFICATE STATE OF ____________ ) ) SS COUNTY OF __________ ) I HEREBY CERTIFY that a meeting of the Partners of ____________________ _____________________________________________________________________, a partnership existing under the laws of the State of _________________________, held on ____________________, 2024, the following resolution was duly passed and adopted: “RESOLVED, that _____________________________________________, as_____________________________________________________________of the Partnership, be and is hereby authorized to execute the Proposal dated ______________, 2024, to the City of South Miami for RFP No. FN2024-17 Janitorial Services from this partnership and that his execution of thereof, attested by the shall be the official act and deed of this Partnership.” I further certify that said resolution is now in full force and effect. IN WITNESS WHEREOF, I have hereunto set my hand this _____, day of ________, 2024. _______________________ Secretary (SEAL) 30 of 92 548 549 FORM 3 SINGLE EXECUTION AFFIDAVITS Tins form must be signed and sworn to in the presence of a notary public or OTHER official authorized to administer oaths. THIS FORM COMBINES SEVERAL AFFIDAVIT STATEMENTS TO BE SWORN TO BY THE PROPOSER OR PROPOSER AND NOTARIZED BELOW.IN THE EVENT THE PROPOSER OR PROPOSER CANNOT SWEAR TO ANY OF THESE AFFIDAVIT STATEMENTS,THE PROPOSER OR PROPOSER IS DEEMED TO BE NON¬ RESPONSIBLE AND IS NOT ELIGIBLE TO SUBMIT A PROPOSAL/PROPOSAL. THESE SINGLE EXECUTION AFFIDAVITS ARE SUBMITTED TO THE CITY OF SOUTH MIAMI AND ARE STATEMENTS MADE: By:pUiAA vgrfTz For (Name of Proposing or Bidding Entity): Whose business address is:_J^Ji£j2—1 And (if applicable)its Federal Employer Identification Number (FEIN)is:'-0$Z-7 f (if the entity does not have an FEIN,include the Social Security Number of the individual signing this sworn statement.SS#:) Americans with Disabilities Act Compliance Affidavit The above named firm,corporation or organization is in compliance with and agrees to continue to comply with,and assure that any subcontractor,or third party contractor under this project complies with all applicable requirements of the laws listed below including,but not limited to, those provisions pertaining to employment,provision of programs and services,transportation, communications,access to facilities,renovations,and new construction. •The American with Disabilities Act of 1990 (ADA),Pub.L.101-336.104 Stat 327,42 USC 1210112213 and 47 USC Sections 225 and 661 including Title 1,Employment:Title 11,Public Services;Title 111.Public Accommodations and Services Operated by Private entities;Title IV,Telecommunications;and Title V,Miscellaneous Provisions. •The Florida Americans with Disabilities Accessibility Implementation Act of 1993. Section 553.501-553.5 13,Florida Statutes: •The Rehabilitation Act of 1 973,229 USC Section 794: •The Federal Transit Act.as amended 49 USC Section 1612; •The Fair 1 lousing Act as amended 42 USC Section 3601 -363 1 . -4Proposer Initials 31 of 92 Public Entity Crimes Affidavit I understand that a “public entity crime” as defined in Paragraph 287.133(1)(g), Florida Statutes, means a violation of any state or federal law by a person with respect to and directly related to the transaction of business with any public entity or with an agency or political subdivision of any other state or of the United States, including but not limited to, any Proposal or contract for goods or services to be provided to any public entity or an agency or political subdivision of any other state or of the United States and involving antitrust, fraud, theft, bribery, collusion, racketeering, conspiracy, or material misrepresentations. I understand that “convicted” or “conviction” as defined in Paragraph 287.133(1)(b), Florida Statutes, means a finding of guilt or a conviction of a public entity crime, with or without an adjudication of guilt, in any federal or state trial court of record relating to charges brought by indictment or information after July 1, 1989, as a result of a jury verdict, non-jury trial, or entry of a plea of guilty or nolo contendere. I understand that an “affiliate” as defined in Paragraph 287.133(1)(a), Florida Statutes, means: 1. A predecessor or successor of a person convicted of a public entity crime; or 2. An entity under the control of any natural person who is active in the management of the entity and who has been convicted of a public entity crime. The term “affiliate” includes those officers, directors, executives, partners, shareholders, employees, members, and agents who are active in the management of an affiliate. The ownership by one person of shares constituting a controlling interest in another person, or a pooling of equipment or income among persons when not for fair market value under an arm’s length agreement, shall be a prima facie case that one person controls another person. A person who knowingly enters into a joint venture with a person who has been convicted of a public entity crime in Florida during the preceding 36 months shall be co nsidered an affiliate. I understand that a “person” as defined in Paragraph 287.133(1)(e), Florida Statutes, means any natural person or entity organized under the laws of any state or of the United States with the legal power to enter into a binding contract and which proposals or applies to Proposal on contracts for the provision of goods or services let by a public entity, or which otherwise transacts or applies to transact business with a public entity. The term “person” includes those officers, directors, executives, and partners, shareholders, employees, members, and agents who are active in management of an entity. Based on information and belief, the statement, which I have marked below, is true in relations to the entity submitting this sworn statement. (INDICATE WHICH STATEMENT APPLIES.) Neither the entity submitting this sworn statement, nor any of its officers, directors, executives, partners, shareholders, employees, members, or agents who are active in the management of the entity, nor any affiliate of the entity has been charged with ad convicted of a public entity crime subsequent to July 1, 1989. The entity submitting this sworn statement, or one or more of its officers, directors, executives, partners, shareholders, employees, members, or agents who are active in the 32 of 92 550 management of the entity, or an affiliate of the entity has been charged with and convicted of a public entity crime subsequent to July 1, 1989. The entity submitting this sworn statement, or one or more of its officers, directors, executives, partners, shareholders, employees, members, or agents who are active in the management of the entity, or an affiliate of the entity has been charged with and convicted of a public entity crime subsequent to July 1, 1989. However, there has been a subsequent proceeding before a Hearing Officer of the State of Florida , Division of Administrative Hearings and the final Order entered by the Hearing Officer determined that it was not in the public interest to place the entity submitting this sworn statement on the convicted vendor list (attach a copy of the final order). I understand that the submission of this form to the contracting officer for the public entity identified in paragraph 1 above is for that public entity only and that this form is valid through December 31 of the calendar year in which it is filed. I also understand that I am required to inform the public entity prior to entering into a contract in excess of the threshold amount provided in Section 287.017, Florida Statutes for category two of any change in the information contained in this form. Proposer Initials No Conflict of Interest or Contingent Fee Affidavit Proposer warrants that neither it nor any principal, employee, agent, representative nor family member has paid or will pay any fee or consideration that is contingent on the award or execution of a contract arising out of this solicitation. Proposer also warrants that neither it nor any principal, employee, agent, representative nor family member has procured or attempted to procure this contract in violation of any of the provisions of the Miami-Dade County and City of South Miami conflict of interest or code of ethics ordinances. Further, Proposer acknowledges that any violation of these warrants will result in the termination of the contract and forfeiture of funds paid or to be paid to the Proposer should the Proposer be selected for the performance of this contract. Proposer Initials Business Entity Affidavit Proposer hereby recognizes and certifies that no elected official, board member, or employee of the City of South Miami (the " City”) shall have a financial interest directly or indirectly in this transaction or any compensation to be paid under or through this transaction, and further, that no City employee, nor any elected or appointed officer (including City board members) of the City, nor any spouse, parent or child of such employee or elected or appointed officer of the City, may be a partner, officer, director or proprietor of Proposer or Vendor, and further, that no such City employee or elected or appointed officer, or the spouse, parent or child of any of them, alone or in combination, may have a material interest in the Vendor or Proposer. Material interest means direct or indirect ownership of more than 5% of the total assets or capital stock of the Proposer. Any exception to these above described restrictions must be expressly provided by applicable law or ordinance and be confirmed in writing by City. Further, Proposer recognizes that with respect to this transaction or Proposal, if any Proposer violates or is a party to a violation of the ethics 33 of 92 551 ordinances or rules of the City, the provisions of Miami-Dade County Code Section 2-11.1, as applicable to City, or the provisions of Chapter 112, part III, Fla. Stat., the Code of Ethics for Public Officers and Employees, such Proposer may be disqualified from furnishing the goods or services for which the Proposal or Proposal is submitted and may be further disqualified from submitting any future proposals or Proposal for goods or services to City. Proposer Initials Anti-Collusion Affidavit 1. Proposer/Proposer has personal knowledge of the matters set forth in its Proposal/Proposal and is fully informed respecting the preparation and contents of the attached Proposal/Proposal and all pertinent circumstances respecting the Proposal/Proposal; 2. The Proposal/Proposal is genuine and is not a collusive or sham Proposal/Proposal; and 3. Neither the Proposer/Proposer nor any of its officers, partners, owners, agents, representatives, employees, or parties in interest, including Affiant, has in any way colluded, conspired, connived, or agreed, directly or indirectly with any other Proposer/Proposer, firm, or person to submit a collusive or sham Proposal/Proposal, or has in any manner, directly or indirectly, sought by agreement or collusion or communication or conference with any other Proposer/Proposer, firm, or person to fix the price or prices in the attached Proposal/Proposal or of any other Proposer/Proposer, or to fix any overhead, profit, or cost element of the Proposal/Proposal price or the Proposal/Proposal price of any other Proposer/Proposer, or to secure through any collusion, conspiracy, connivance or unlawful agreement any advantage against the City or any person interested in the proposed Contract. __________ Proposer Initials Scrutinized Company Certification 1. Proposer certifies that it and its subcontractors are not on the Scrutinized Companies that Boycott Israel List. Pursuant to Section 287.135, F.S., the City may immediately terminate the Agreement that may result from this RFP at its sole option if the Proposer or its subcontractors are found to have submitted a false certification; or if the Proposer, or its subcontractors are placed on the Scrutinized Companies that Boycott Israel List or is engaged in the boycott of Israel during the term of the Agreement. 2. If the Agreement that may result from this RFP is for more than one million dollars, the Proposer certifies that it and its subcontractors are also not on the Scrutinized Companies with Activities in Sudan, Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List, or engaged with business operations in Cuba or Syria as identified in Section 287.135, F.S. pursuant to Section 287.135, F.S., the City may immediately terminate the Agreement that may result from this RFP at its sole option if the Proposer, its affiliates, or its subcontractors are found to have submitted a false certification; or if the Proposer, its affiliates, or its subcontractors are placed on the Scrutinized Companies with Activities in Sudan List, or 34 of 92 552 Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List, or engaged with business operations in Cuba or Syria during the term of the Agreement. 3. The Proposer agrees to observe the above requirements for applicable subcontracts entered into for the performance of work under the Agreement that may result from this RFP. As provided in Subsection 287.135(8), F.S., if federal law ceases to authorize the above-stated contracting prohibitions then they shall become inoperative. Proposer Initials Drug-Free Workplace Affidavit Proposer hereby recognizes that, pursuant to F.S. § 287.087, preference shall be given to businesses with drug-free workplace programs when two proposals/Proposal are equal with respect to price, quality, and service. Proposer understands that in order to qualify as a drug-free workplace, Proposer must: a) Publish a statement notifying employees that the unlawful manufacture, distribution, dispensing, possession, or use of a controlled substance is prohibited in the workplace and specifying the actions that will be taken against employees for violations of such prohibition. b) Inform employees about the dangers of drug abuse in the workplace, the Proposer’s policy of maintaining a drug-free workplace, any available drug counseling, rehabilitation, and employee assistance programs, and the penalties that may be imposed upon employees for drug abuse violations. 1) Give each employee engaged in providing commodities or contractual services under the RFP a copy of the statement specified in subsection (1). 2) Notify employees that, as a condition of working on the commodities or contractual services under the RFP, the employee must abide by the terms of the statement and will notify the employer of any conviction of, or plea of guilty or nolo contendere to, any violation of chapter 893 or of any controlled substance law of the United States or any state, for a violation occurring in the workplace no later than five (5) days after such conviction. 3) Impose a sanction on, or require the satisfactory participation in a drug abuse assistance or rehabilitation program if such is available in the employee’s community, by any employee who is so convicted. 4) Make a good faith effort to continue to maintain a drug-free workplace through the implementation of this section. Based on information and belief, the statement, which I have marked below, is true in relations to the entity submitting this sworn statement. (INDICATE WHICH STATEMENT APPLIES.) The entity submitting this sworn statement is a drug-free workplace and is in full 35 of 92 1,918.00 553 compliance with the requirements set forth under F.S. § 287.087. The entity submitting this sworn statement is not a drug-free workplace. Proposer Initials City Non-Discrimination Requirements Affidavit Proposer understands that pursuant to Section 3-1.1 of the Code of the City of South Miami, the City will not enter into or award a contract to an entity engaged in a boycott. Proposer understands that “Boycott” as defined under Section 3 -1.1 of the Code of the City of South Miami means to blacklist, divest from, or otherwise refuse to deal with a nation or country, or to blacklist or otherwise refuse to deal with a person or entity when the action is based on race, color, national origin, religion, sex, gender identity, sexual orientation, marital or familial status, age, or disability in a discriminatory manner. The term boycott does not include a decision based upon business or economic reasons, or boycotts, embargoes, trade restrictions, or divestments that are specifically authorized or required by federal law or state law. Proposer certifies that it is not engaged in a boycott, and is in full compliance with Section 3 -1.1 of the Code of the City of South Miami. Proposer Initials Acknowledgment, Warranty, and Acceptance 1. Contractor warrants that it is willing and able to comply with all applicable state of Florida laws, rules and regulations. 2. Contractor warrants that it has read, understands, and is willing to comply with all requirements of RFP No. FN2024-03 and any addendum/addenda related thereto. 3. Contractor warrants that it will not delegate or subcontract its responsibilities under an agreement without the prior written permission of the City Commission or City Manager, as applicable. 4. Contractor warrants that all information provided by it in connection with this Proposal is true and accurate. Proposer Initials [REMAINDER OF PAGE LEFT INTENTIONALLY BLANK. SIGNATURE PAGE FOLLOWS.] 36 of 92 554 555 State of Florida County of kJ&MJL -LhCC ACKNOWLEDGMENT mp,or Type as issioned) .20^by 5 OAN1 CAklt-O (type of authority)for online notarization,this 2-T day of^AN/j^iL^GiCfct (name of person)as 0 fcKcTr (name of party on behalf of whom instrument is executed). The foregoing instrument was acknowledged before me by means of physical presence or_ GUSTAVO A.HERRERAj-jt MY COMMISSION #HH 423473EXPIRES:July 31,2027 Personally known to me;or.X Produced identification (Type of Identification: x) Did take an oath:or Did not take an oath 37 of 92 556 FORM 4 DISPUTE DISCLOSURE Answer the following questions by placing an “X”after “Yes”or “No”.If you answer “Yes”, please explain in the space provided,or on a separate sheet attached to this form. 1.Has your firm or any of its officers,received a reprimand of any nature or been suspended by the Department of Professional Regulations or any other regulatory agency or professional associations within the last five (5)years? YES NO \Z 2.Has your firm,or any member of your firm,been declared in default,terminated or removed from a contract or job related to the services your firm provides in the regular course of business within the last five (5)years? YES NO 3.Has your firm had against it or filed any requests for equitable adjustment,contract claims. Proposal protests,or litigation in the past five (5)years that is related to the services your firm provides in the regular course of business? YES NO J If yes.state the nature of the request for equitable adjustment,contract claim,litigation,or protest, and state a brief description of the case,the outcome or status of the suit and the monetary amounts of extended contract time involved. ACKNOWLEDGMENT I hereby certify that all statements made are true and agree and understand that any misstatement or misrepresentation of falsification of facts shall be cause for forfeiture of rights for further consideration of this Proposal or Proposal for the City of South Miami. State of Florida County of YU-lftuJ- The foregoing instrument was acknowledged before me by means of [y physical presence or online notarization, this day of ,20 ,by dufW CAku.Cc>(name of person) as gyVNcV—(type of authority)ford (name of party on behalf of whom instrument is executed). GUSTAVO A.HERRERA MY COMMISSION #HH 423473 EXPIRES:July 31,2027 Personally known to me;or Produced identification (Type of Identification: Did take an oath;or Did not take an oath Commissioned) 38 of 92 FORM 5 CERTIFICATION REGARDING DEBARMENT, SUSPENSION, AND OTHER RESPONSIBILITY MATTERS PRIMARY COVERED TRANSACTIONS This certification is required by the regulations implementing Executive Order 12549, Debarment and Suspension, 13 CFR Part 145. The regulations were published as Part VII of the May 26, 1988 Federal Register (pages 19160-19211). Copies of the regulations are available from local offices of the U.S. Small Business Administration. (1)The prospective primary participant certifies to the best of its knowledge and belief that it and its principals: (a) Are not presently debarred, suspended, proposed for disbarment, declared ineligible, or voluntarily excluded from covered transactions by any Federal department or agency; (b) Have not within a three-year period preceding this application been convicted of or had a civil judgment rendered against them for commission of fraud or a criminal offense in connection with obtaining, attempting to obtain, or performing a public (Federal, State, or local) transaction or contract under a public transaction; violation of Federal or State antitrust statutes or commission of embezzlement, theft, forgery, bribery, falsification or destruction of records, making false statements, or receiving stolen property; (c) Are not presently indicted for or otherwise criminally or civilly charged by a governmental entity (Federal, State, or local) with commission of any of the offenses enumerated in paragraph (1)(b) of this certification; and (d) Have not within a three-year period preceding this application had one or more public transactions (Federal, State, or local) terminated for cause or default. (2)Where the prospective primary participant is unable to certify to any of the statements in this certification, such prospective primary participant shall attach an explanation to this Statement of Qualifications. Business Name_________________________________________________________ Date_________________________ By: Signature of Authorized Representative Name and Title of Authorized Representative 39 of 92 Juan Perez - President J.Perez Enterprises, Inc. D/B/A High Maintenance Services 01/23/2025 557 FORM 6 PROPOSER’S QUALIFICATIONS SURVEY COMPANY QUALIFICATIONS QUESTIONNAIRE Please complete this Company Qualifications Questionnaire. By completing this form and submitting a response to the RFP, you certify that any and all information contained in the Proposal is true, that your response to the RFP is made without prior understanding, agreement, or connections with any corporation, firm or person submitting a response to the RFP for the same materials, supplies, equipment, or services, is in all respects fair and without collusion or fraud, that you agree to abide by all terms and conditions of the RFP, and certify that you are authorized to sign for the Proposer’s firm. Some responses may require the inclusion of separate attachments. Separate attachments should be as concise as possible, while including the requested information. In no event should the total page count of all attachments to this Form exceed five (5) pages. Some information may not be applicable; in such instances, please insert “N/A”. Firm Name Principal Business Address Telephone Number Facsimile Number Email Address Federal I.D. No. or Social Security Number Municipal Business Tax/Occupational License No. FIRM HISTORY AND INFORMATION How many years has the firm has been in business under its current name and ownership? Please identify the Firm’s document number with the Florida Division of Corporations and date the Firm registered/filed to conduct business in the State of Florida: Document Number Date Filed Please identify the Firm’s category with the Florida Department of Business Professional Regulation (DBPR), DBPR license number, and date licensed by DBPR: Category License No. Date Licensed 40 of 92 J.Perez Enterprises, Inc. D/B/A High Maintenance Services 4380 SW 74th Ave Miami FL 33155 786-350-3958 ext 6414 bids@highmaintenanceservices.com 510527967 5695227 21 P04000134404 09/27/2004 not applicable 558 Please indicate the type of entity form of the Firm (if other, please describe): □ Individual □ Partnership □ Corporation □ LLC □ LLP □ Other Please identify the Firm’s primary business: Please identify the number of continuous years your Firm has performed its primary business: Please list all professional licenses and certifications held by the Firm, its Qualifier/Principal, and any Key Staff, including any active certifications of small, minority, or disadvantaged business enterprise, and the name of the entity that issued the license or certification: License/Certification Type Name of Entity Issuing License or Certification License No. License Issuance Date Please identify the name, license number, and issuance date of any prior companies that pertain to your Firm: License/Certification Type Name of Entity Issuing License or Certification License No. License Issuance Date Please identify all individuals authorized to sign for the entity, their title, and the threshold/level of their signing authority: Authorized Signor’s Name Title Signing Authority Threshold (All, Cost up to $X-Amount, No Cost, Other) Please identify the total number of Firm employees, managerial/administrative employees, and identify the total number of trades employees by trade (e.g., 20 electricians, 5 laborers, 2 mechanics, etc.): Total No. of Employees Total No. of Managerial/Administrative Employees Total No. of Trades Employees by Trade INSURANCE INFORMATION Please provide the following information about the Firm’s insurance company: Insurance Carrier Name Insurance Carrier Contact Person 41 of 92 LIBERTY MUTUAL GENERAL LIABILITY AND AUTO TRAVELERS FOR WORKERS COMPENSATION 559 Insurance Carrier Address Telephone No. Email Has the Firm filed any insurance claims in the last five (5) years? □ No □ Yes If yes, please identify the type of claim and the amount paid out under the claim: FIRM OWNERSHIP Please identify all Firm owners or partners, their title, and percent of ownership: Owner/Partner Name Title Ownership (%) Please identify whether any of the owners/partners identified above are owners/partners in another entity: □ No □ Yes If yes, please identify the name of the owner/partner, the other entity’s name, and percent of ownership held by the stated owner/partner: Owner/Partner Name Other Entity Name Ownership (%) RECENT CONTRACTS Please identify the five (5) most recent contracts in which your Firm has provided services to other public entities: Public Entity Name Contact Person Telephone No. Email Address Date Awarded By signing below, Proposer certifies that the information contained herein is complete and accurate to the best of Proposer’s knowledge. Firm: Authorized Signature: Date: Print or Type Name: Title: 42 of 92 Juan Perez President 100 Dept of State AP INTEGO NEXT INSURANCE 888-289-2939 DUANE LAMBERT LambertDM@state.gov 11/2022+502-2326-4388 Coral Gables Museum susana@coralgablesmuseum.org 01/2010Susana Chapur 305-603-8067 Dade Heritage Trust Christy Rupp chris@dadeheritagetrust.org 01/2015305-910-3996 Colombian consulate DAVID BERNAL David.Bernal@cancilleria.gov.co 01/2005 J.Perez Enterprises, Inc. D/B/A High Maintenance Services 01/23/2025 Juan Perez President 560 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services, Section 3. NOTE: OVER THE TERM OF THE AGREEMENT, THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS, DEPENDING UPON CONDITIONS. IN THOSE CASES, THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES” MATRIX BELOW. A. ANNUAL FEE YEAR ANNUAL FEE Year 1 $ Year 2 $ Year 3 $ Year 4 (Option Year) $ Year 5 (Option Year) $ TOTAL $ B. SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch; City Hall (1st & 2nd Floor); Police Department (1st & 2nd Floor) $ Community Center (Multi-Purpose, Arts & Crafts Computer Lab & Education Room) $ Indoor Basketball Gymnasium/Bleachers $ Marshall Williamson building, commonly known as Mobley building $______________________ 43 of 92 89,400.00 93,870.00 98,563.50 103,491.67 $105,986.00 491,311.17 18,249 sqf 22,610 sqf 8394 sqf 9534 sqf 25,084.72 30,975.70 11,499.78 13,061.58 561 Senior Citizens Center $ Public Works $ Dante Fascell Park $______________________ Firm: Authorized Signature: Date: Print or Type Name: Title: 44 of 92 2900 sqf 1951 sqf 1400 sqf 3973.00 2,672.87 1,918.00 J.Perez Enterprises, Inc. D/B/A High Maintenance Services 01/22/2025 JUAN PEREZ PRESIDENT 562 FORM 8 REFERENCE LIST IN ADDITION TO THE INFORMATION REQUIRED ON THIS FORM, PROPOSER SHALL PROVIDE A MINIMUM OF FOUR (4) REFERENCE LETTERS. REFERENCE #1 Public Entity Name: Reference Contact Person/Title/Department: Contact Number & Email Public Entity Size/Number of Residents/Square Mileage: Event(s) Completed (include Name of Project/Event, Date of Event Start/Completion, Details on Size/Scope of Work/Complexity) Is the Contract still Active? Yes No 45 of 92 DEPT OF STATE US EMBASSY LambertDM@state.gov +502-2326-4388 OVER 200K SQFT JANITORIAL SERVICES OF NEW AND FORMER EMBASSY COMPOUND PLUS ANNEX OFFICES YES DUANE LAMBERT FACILITY MANAGER 563 REFERENCE #2 Public Entity Name: Reference Contact Person/Title/Department: Contact Number & Email Public Entity Size/Number of Residents/Square Mileage: Event(s) Completed (include Name of Project/Event, Date of Event Start/Completion, Details on Size/Scope of Work/Complexity) Is the Contract still Active? Yes No 46 of 92 COLOMBIAN MINISTRY OF FOREIGN AFFAIRS COLOMBIAN CONSULATES DAVID BERNAL PROCUREMENT DAVID.Bernal@cancilleria.gov.co JANITORIAL SERVICES TO CONSULATES X 305-548-9804 20K SQF MULTI OFFICE 564 REFERENCE #3 Public Entity Name: Reference Contact Person/Title/Department: Contact Number & Email Public Entity Size/Number of Residents/Square Mileage: Event(s) Completed (include Name of Project/Event, Date of Event Start/Completion, Details on Size/Scope of Work/Complexity) Is the Contract still Active? Yes No 47 of 92 Coral Gables Museum Susana Chapur Office manager susana@coralgablesmuseum.org 305-603-8067 15k sqf JANITORIAL SERVICES X 565 REFERENCE #4 Public Entity Name: Reference Contact Person/Title/Department: Contact Number & Email Public Entity Size/Number of Residents/Square Mileage: Event(s) Completed (include Name of Project/Event, Date of Event Start/Completion, Details on Size/Scope of Work/Complexity) Is the Contract still Active? Yes No 48 of 92 Dade Heritage Trust Christy Rupp Chris@dadeheritagetrust.org DIRECTOR VARIOUS JANITORIAL AND MAINTENANCE SERVICES X 566 FORM 9 KEY STAFF & PROPOSED SUBCONTRACTORS KEY STAFF Please complete the following chart with the Firm’s proposed Key Staff. If additional space is required, please copy/duplicate this page and attach to this Form. Additional space: □ No □ Yes Name Title Years of Experience Years with Firm Licenses/Certifications Please explain the Firm’s ability and resources to substitute personnel with equal or higher qualifications than the Key Staff they will substitute for where substitute is required due to attrition, turnover, or a specific request by the City: 49 of 92 JUAN PEREZ PRESIDENT 21 21 N/A Jamilet Vazquez Operations 35 20 n/a Valentina Munoz Operations 10 10 n/a Sebastian Arciniegas Operations 10 10 n/a HMS is in business because of loyal and professional employees. Our turn over is lower than the average for a janitorial services in Miami, this is due to our incentive plan and employee management program. If replacements are required we have suitable staff in nearby contracts that can be easily transfered when required. 567 Please identify each Key Staff member’s engagement commitments that will exist concurrently with the City’s Services: Key Staff Name Area of Responsibility Client Commitment (Hours/week) Period of Engagement PROPOSED SUBCONTRACTORS The undersigned Proposer hereby designates, as follows, all major subcontractors whom they propose to utilize for the major areas of work for the services. The bidder is further notified that all subcontractors shall be properly licensed, bondable, and shall be required to furnish the City with a Certificate of Insurance in accordance with the contract general conditions. Failure to furnish this information shall be grounds for rejection of the bidder’s proposal. (If no subcontractors are proposed, state “None” on first line below.) Subcontractor Name & Address Scope of Work License Number Firm: Authorized Signature: Date: Print or Type Name: Title: 50 of 92 n/a Jamilet Vazquez Operations Coral Gables 40 Full Time J.Perez Enterprises, Inc. D/B/A High Maintenance Services 01/23/2025 Juan Perez President Will be assigned to City of South Miami Full Time Sebastian Arciniegas Operations Various 40 Full time 568 ATTACHMENT A SAMPLE AGREEMENT NOTE: THE CONSULANT SHOULD BE PREPARED TO EXECUTE THIS SAMPLE AGREEMENT IN SUBSTANTIALLY THE FORM PROVIDED HEREIN UPON NOTICE OF AWARD AND SELECTION. THE TERMS OF THE AGREEMENT MAY ONLY BE NEGOTIATED AT THE CITY MANAGER OR DESIGNEE’S SOLE AND ABSOLUTE DISCRETION. PROFESSIONAL SERVICES AGREEMENT BETWEEN THE CITY OF SOUTH MIAMI AND J.PEREZ ENTERPRISES, INC. DBA HIGH MAINTENANCE SERVICES (HMS) THIS AGREEMENT (this “Agreement”) is made effective as of the day of , 2024 (the “Effective Date”), by and between the CITY OF SOUTH MIAMI, a Florida municipal corporation, (hereinafter the “City”), and HMS (hereinafter, the “Consultant”). WHEREAS, the City requires Janitorial Services at various locations withing the City (the “Services”); and WHEREAS, on 01/23/2025, the City issued Request for Proposals No. FN2024-17 (the “RFP”) for the Services, which RFP is attached hereto as Exhibit “A”; and WHEREAS, the Consultant submitted a Proposal in response to the RFP, which Proposal is attached hereto as Exhibit “B”; and WHEREAS, on 01/23/2025, the City Commission adopted Resolution No. ________________, approving the award of this Agreement to the Consultant for the provision of the Services pursuant to the RFP; and WHEREAS, the Consultant and City, through mutual negotiation, have agreed upon a fee for the Services; and WHEREAS, the City desires to engage the Consultant to perform the Services and provide the deliverables as specified below. NOW, THEREFORE, in consideration of the mutual covenants and conditions contained herein, the Consultant and the City agree as follows: 1.Scope of Services. 1.1. Consultant shall provide the Services set forth in the RFP attached hereto as Exhibit “A” and the Proposal attached hereto as Exhibit “B” and incorporated herein by reference (the “Services”). 51 of 92 569 1.2. Consultant shall furnish all reports, documents, and information obtained pursuant to this Agreement, and recommendations during the term of this Agreement (hereinafter “Deliverables”) to the City. 2.Term/Commencement Date. 2.1. The term of this Agreement shall be from the Effective Date through three (3) years thereafter, unless earlier terminated in accordance with Paragraph 8. Additionally, the City Manager may renew this Agreement for two (2) additional one-year periods on the same terms as set forth herein upon written notice to the Consultant for a total term of five (5) consecutive years. 2.2. Consultant agrees that time is of the essence and Consultant shall complete the Services within the term of this Agreement, unless extended by the City Manager. 3.Compensation and Payment. 3.1. Compensation for Services provided by Consultant shall be in accordance with the Proposal attached hereto as Exhibit “B.” Consultant shall be compensated a flat rate lump sum fee for each year of the Agreement in accordance with Exhibit “B”. 3.2. Consultant shall deliver an invoice to City no more often than once per month detailing Services completed and the amount due to Consultant under this Agreement. Fees shall be paid in arrears each month, pursuant to Consultant’s invoice, which shall be based upon the percentage of work completed for each task invoiced. The City shall pay the Consultant in accordance with the Florida Prompt Payment Act after approval and acceptance of the Services by the City Manager. 4.Subconsultants. 4.1. The Consultant shall be responsible for all payments to any subconsultants and shall maintain responsibility for all work related to the Services. 4.2. Consultant may only utilize the services of a particular subconsultant with the prior written approval of the City Manager, which approval may be granted or withheld in the City Manager’s sole and absolute discretion. 5.City’s Responsibilities. 5.1. City shall make available any maps, plans, existing studies, reports, staff and representatives, and other data pertinent to the Services and in possession of the City, and provide criteria requested by Consultant to assist Consultant in performing the Services. 5.2. Upon Consultant’s request, City shall reasonably cooperate in arranging access to public information that may be required for Consultant to perform the Services. 6.Consultant’s Responsibilities; Representations and Warranties. 6.1. The Consultant shall exercise the same degree of care, skill and diligence in the performance of the Services as is ordinarily provided by a consultant under similar circumstances. If at any time during the term of this Agreement or within two (2) years from the completion of this Agreement, it is determined that the Consultant’s Deliverables or Services are incorrect, not properly rendered, 52 of 92 570 defective, or fail to conform to City requests, the Consultant shall at Consultant’s sole expense, immediately correct its Deliverables or Services. 6.2. The Consultant hereby warrants and represents that at all times during the term of this Agreement it shall maintain in good standing all required licenses, certifications and permits required under Federal, State and local laws applicable to and necessary to perform the Services for City as an independent contractor of the City. Consultant further warrants and represents that it has the required knowledge, expertise, and experience to perform the Services and carry out its obligations under this Agreement in a professional and first class manner. 6.3. The Consultant represents that is an entity validly existing and in good standing under the laws of Florida. The execution, delivery and performance of this Agreement by Consultant have been duly authorized, and this Agreement is binding on Consultant and enforceable against Consultant in accordance with its terms. No consent of any other person or entity to such execution, delivery and performance is required. 7.Conflict of Interest. 7.1. To avoid any conflict of interest or any appearance thereof, Consultant shall not, for the term of this Agreement, provide any consulting services to any private sector entities (developers, corporations, real estate investors, etc.), with any current, or foreseeable, adversarial issues in the City. 8.Termination. 8.1. The City Manager, without cause, may terminate this Agreement upon five (5) calendar days written notice to the Consultant, or immediately with cause. 8.2. Upon receipt of the City's written notice of termination, Consultant shall immediately stop work on the project unless directed otherwise by the City Manager. 8.3. In the event of termination by the City, the Consultant shall be paid for all work accepted by the City Manager up to the date of termination, provided that the Consultant has first complied with the provisions of Paragraph 8.4. 8.4. The Consultant shall transfer all books, records, reports, working drafts, documents, maps, and data pertaining to the Services and the project to the City, in a hard copy and electronic format within fourteen (14) days from the date of the written notice of termination or the date of expiration of this Agreement. 9.Insurance. 9.1. Consultant shall secure and maintain throughout the duration of this agreement insurance of such types and in such amounts not less than those specified below as satisfactory to City, naming the City as an Additional Insured, underwritten by a firm rated A-X or better by A.M. Best and qualified to do business in the State of Florida. The insurance coverage shall be primary insurance with respect to the City, its officials, employees, agents, and volunteers naming the City as additional insured. Any insurance maintained by the City shall be in excess of the Consultant’s insurance and shall not contribute to the Consultant’s insurance. The insurance coverages shall include at a minimum the amounts set forth in this section and may be increased by the City as it deems necessary or prudent. 53 of 92 571 9.1.1. Commercial General Liability coverage with limits of liability of not less than a $1,000,000 per Occurrence combined single limit for Bodily Injury and Property Damage. This Liability Insurance shall also include Completed Operations and Product Liability coverages and eliminate the exclusion with respect to property under the care, custody and control of Consultant. The General Aggregate Liability limit and the Products/Completed Operations Liability Aggregate limit shall be in the amount of $2,000,000 each. 9.1.2. Workers Compensation and Employer’s Liability insurance, to apply for all employees for statutory limits as required by applicable State and Federal laws. The policy(ies) must include Employer’s Liability with minimum limits of $1,000,000.00 each accident. No employee, subcontractor or agent of the Consultant shall be allowed to provide Services pursuant to this Agreement who is not covered by Worker’s Compensation insurance. 9.1.3. Business Automobile Liability with minimum limits of $1,000,000 per occurrence, combined single limit for Bodily Injury and Property Damage. Coverage must be afforded on a form no more restrictive than the latest edition of the Business Automobile Liability policy, without restrictive endorsements, as filed by the Insurance Service Office, and must include Owned, Hired, and Non-Owned Vehicles. 9.1.4. Professional Liability Insurance in an amount of not less than One Million Dollars ($1,000,000.00) per occurrence, single limit. 9.2. Certificate of Insurance. Certificates of Insurance shall be provided to the City, reflecting the City as an Additional Insured (except with respect to Professional Liability Insurance and Worker’s Compensation Insurance), no later than ten (10) days after award of this Agreement and prior to the execution of this Agreement by City and prior to commencing Services. Each certificate shall include no less than (30) thirty-day advance written notice to City prior to cancellation, termination, or material alteration of said policies or insurance. The Consultant shall be responsible for assuring that the insurance certificates required by this Section remain in full force and effect for the duration of this Agreement, including any extensions or renewals that may be granted by the City. The Certificates of Insurance shall not only name the types of policy(ies) provided, but also shall refer specifically to this Agreement and shall state that such insurance is as required by this Agreement. The City reserves the right to inspect and return a certified copy of such policies, upon written request by the City. If a policy is due to expire prior to the completion of the Services, renewal Certificates of Insurance shall be furnished thirty (30) calendar days prior to the date of their policy expiration. Each policy certificate shall be endorsed with a provision that not less than thirty (30) calendar days’ written notice shall be provided to the City before any policy or coverage is cancelled or restricted. Acceptance of the Certificate(s) is subject to approval of the City. 9.3. Additional Insured. Except with respect to Professional Liability Insurance and Worker’s Compensation Insurance, the City is to be specifically included as an Additional Insured for the liability of the City resulting from Services performed by or on behalf of the Consultant in performance of this Agreement. The Consultant’s insurance, including that applicable to the City as an Additional Insured, shall apply on a primary basis and any other insurance maintained by the City shall be in excess of and shall not contribute to the Consultant’s insurance. The Consultant’s insurance shall contain a severability of interest provision providing that, except with respect to the total limits of liability, the insurance shall apply to each Insured or Additional Insured (for applicable policies) in the same manner as if separate policies had been issued to each. 54 of 92 572 9.4. Deductibles. All deductibles or self-insured retentions must be declared to and be reasonably approved by the City. The Consultant shall be responsible for the payment of any deductible or self-insured retentions in the event of any claim. 9.5. The provisions of this section shall survive termination of this Agreement. 10.Nondiscrimination. During the term of this Agreement, Consultant shall not discriminate against any of its employees or applicants for employment because of their race, color, religion, sex, or national origin, and to abide by all Federal and State laws regarding nondiscrimination. 11.Attorneys Fees and Waiver of Jury Trial. 11.1. In the event of any litigation arising out of this Agreement, the prevailing party shall be entitled to recover its attorneys’ fees and costs, including the fees and expenses of any paralegals, law clerks and legal assistants, and including fees and expenses charged for representation at both the trial and all appellate levels. 11.2. IN THE EVENT OF ANY LITIGATION ARISING OUT OF THIS AGREEMENT, EACH PARTY HEREBY KNOWINGLY, IRREVOCABLY, VOLUNTARILY AND INTENTIONALLY WAIVES ITS RIGHT TO TRIAL BY JURY. 12.Indemnification. 12.1. Consultant shall indemnify and hold harmless the City, its officers, agents and employees, from and against any and all demands, claims, losses, suits, liabilities, causes of action, judgment or damages, arising from Consultant’s performance or non-performance of any provision of this Agreement, including, but not limited to, liabilities arising from contracts between the Consultant and third parties made pursuant to this Agreement. Consultant shall reimburse the City for all its expenses including reasonable attorneys’ fees and costs incurred in and about the defense of any such claim or investigation and for any judgment or damages arising from Consultant’s performance or non-performance of this Agreement. 12.2. Nothing herein is intended to serve as a waiver of sovereign immunity by the City nor shall anything included herein be construed as consent to be sued by third parties in any matter arising out of this Agreement or any other contract. The City is subject to section 768.28, Florida Statutes, as may be amended from time to time. 12.3. The provisions of this section shall survive termination of this Agreement. 13.Notices/Authorized Representatives. Any notices required by this Agreement shall be in writing and shall be deemed to have been properly given if transmitted by hand-delivery, by registered or certified mail with postage prepaid return receipt requested, or by a private postal service, addres sed to the parties (or their successors) at the addresses listed on the signature page of this Agreement or such other address as the party may have designated by proper notice. 14.Governing Law and Venue. This Agreement shall be construed in accordance with and governed by the laws of the State of Florida. Venue for any proceedings arising out of this Agreement shall be proper exclusively in Miami-Dade County, Florida. 15.Entire Agreement/Modification/Amendment. 55 of 92 573 15.1. This writing contains the entire Agreement of the parties and supersedes any prior oral or written representations. No representations were made or relied upon by either party, other than those that are expressly set forth herein. 15.2. No agent, employee, or other representative of either party is empowered to modify or amend the terms of this Agreement, unless executed with the same formality as this document. 16.Ownership and Access to Records and Audits. 16.1. Consultant acknowledges that all inventions, innovations, improvements, developments, methods, designs, analyses, drawings, reports, compiled information, and all similar or related information (whether patentable or not) which relate to Services to the City which are conceived, developed or made by Consultant during the term of this Agreement (“Services Product”) belong to the City. Consultant shall promptly disclose such Services Product to the City and perform all actions reasonably requested by the City (whether during or after the term of this Agreement) to establish and confirm such ownership (including, without limitation, assignments, powers of attorney and other instruments). 16.2. Consultant agrees to keep and maintain public records in Consultant’s possession or control in connection with Consultant’s performance under this Agreement. The City Manager or her designee shall, during the term of this Agreement and for a period of three (3) years from the date of termination of this Agreement, have access to and the right to examine and audit any records of the Consultant involving transactions related to this Agreement. Consultant additionally agrees to comply specifically with the provisions of Section 119.0701, Florida Statutes. Consultant shall ensure that public records that are exempt or confidential and exempt from public records disclosure requirements are not disclosed, except as authorized by law, for the duration of the Agreement, and following completion of the Agreement until the records are transferred to the City. 16.3. Upon request from the City’s custodian of public records, Consultant shall provide the City with a copy of the requested records or allow the records to be inspected or copied within a reasonable time at a cost that does not exceed the cost provided by Chapter 119, Florida Statutes, or as otherwise provided by law. 16.4. Unless otherwise provided by law, any and all records, including but not limited to reports, surveys, and other data and documents provided or created in connection with this Agreement are and shall remain the property of the City. 16.5. Upon completion of this Agreement or in the event of termination by either party, any and all public records relating to the Agreement in the possession of the Consultant shall be delivered by the Consultant to the City Manager, at no cost to the City, wit hin seven (7) days. All such records stored electronically by Consultant shall be delivered to the City in a format that is compatible with the City’s information technology systems. Once the public records have been delivered upon completion or termination of this Agreement, the Consultant shall destroy any and all duplicate public records that are exempt or confidential and exempt from public records disclosure requirements. 16.6. Any compensation due to Consultant shall be withheld until all records are received as provided herein. 56 of 92 574 16.7. Consultant’s failure or refusal to comply with the provisions of this section shall result in the immediate termination of this Agreement by the City. 16.8. Notice Pursuant to Section 119.0701(2)(a), Florida Statutes. IF THE CONSULTANT HAS QUESTIONS REGARDING THE APPLICATION OF CHAPTER 119, FLORIDA STATUTES, TO THE CONSULTANT’S DUTY TO PROVIDE PUBLIC RECORDS RELATING TO THIS AGREEMENT, CONTACT THE CUSTODIAN OF PUBLIC RECORDS. Custodian of Records: Nkenga “Nikki” Payne, CMC, FCRM Mailing address: 6130 Sunset Drive South Miami, FL 33143 Telephone number: 305-663-6340 Email: NPayne@southmiamifl.gov 17.Nonassignability. This Agreement shall not be assignable by Consultant unless such assignment is first approved by the City Manager. The City is relying upon the apparent qualifications and expertise of the Consultant, and such firm’s familiarity with the City’s area, circumstances and desires. 18.Severability. If any term or provision of this Agreement shall to any extent be held invalid or unenforceable, the remainder of this Agreement shall not be affected thereby, and each remaining term and provision of this Agreement shall be valid and be enforceable to the fullest extent permitted by law. 19.Independent Consultant. The Consultant and its employees, volunteers and agents shall be and remain an independent contractor and not an agent or employee of the City with respect to all of the acts and services performed by and under the terms of this Agreement. This Agreement shall not in any way be construed to create a partnership, association or any other kind of joint undertaking, enterprise or venture between the parties. 20.Compliance with Laws. The Consultant shall comply with all applicable laws, ordinances, rules, regulations, and lawful orders of public authorities in carrying out Services under this Agreement, and in particular shall obtain all required permits from all jurisdictional agencie s to perform the Services under this Agreement at its own expense. 21.Waiver. The failure of either party to this Agreement to object to or to take affirmative action with respect to any conduct of the other which is in violation of the terms of this Agreement shall not be construed as a waiver of the violation or breach, or of any future violation, breach or wrongful conduct. 22.Survival of Provisions. Any terms or conditions of either this Agreement that require acts beyond the date of the term of the Agreement, shall survive termination of the Agreement, shall remain in full force and effect unless and until the terms or conditions are completed and shall be fully enforceable by either party. 23.Prohibition of Contingency Fees. The Consultant warrants that it has not employed or retained any company or person, other than a bona fide employee working solely for the Consultant, to solicit or secure this Agreement, and that it has not paid or agreed to pay any person(s), company, c orporation, 57 of 92 575 individual or firm, other than a bona fide employee working solely for the Consultant, any fee, commission, percentage, gift, or any other consideration, contingent upon or resulting from the award or making of this Agreement. 24.State Required Affidavits. By entering into this Agreement, the Consultant agrees to review and comply with the following state affidavit requirements: 24.1. Public Entity Crimes Affidavit. Consultant shall comply with Section 287.133, Florida Statutes (Public Entity Crimes Statute), notification of which is hereby incorporated herein by reference, including execution of any required affidavit. 24.2. Scrutinized Companies. Consultant certifies that it is not on the Scrutinized Companies that Boycott Israel List or engaged in a boycott of Israel. Pursuant to section 287.135, Florida Statues, the City may immediately terminate this Agreement at its sole option if the Consultant is found to have submitted a false certification; or if the Consultant is placed on the Scrutinized Companies that Boycott Israel List or is engaged in the boycott of Israel during the term of the Agreement. If this Agreement is for more than one million dollars, the Consultant certifies that it is also not on the Scrutinized Companies with Activities in Sudan, Scrutinized Companies with Activities in the Iran Terrorism Sectors List, Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List, or engaged with business operations in Cuba or Syria as identified in Section 287.135, Florida Statutes. Pursuant to Section 287.135, Florida Statutes, the City may immediately terminate this Agreement at its sole option if the Consultant is found to have submitted a false certification; or if the Consultant is placed on the Scrutinized Companies with Activities in Sudan List, Scrutinized Companies with Activities in the Iran Terrorism Sectors List, Scrutinized Companies with Activities in Iran Petroleum Energy Sector List, or engaged with business operations in Cuba or Syria during the term of the Agreement. 24.3. E-Verify Affidavit. In accordance with Section 448.095, Florida Statutes, the City requires all contractors doing business with the City to register with and use the E-Verify system to verify the work authorization status of all newly hired employees. The City will not enter into a contract unless each party to the contract registers with and uses the E- Verify system. The contracting entity must provide of its proof of enrollment in E-Verify. For instructions on how to provide proof of the contracting entity’s participation/enrollment in E-Verify, please visit: https://www.e-verify.gov/faq/how-do- i-provide-proof-of-my-participationenrollment-in-e-verify. By entering into this Agreement, the Consultant acknowledges that it has read Section 448.095, Florida Statutes; will comply with the E-Verify requirements imposed by Section 448.095, Florida Statutes, including but not limited to obtaining E-Verify affidavits from subcontractors; and has executed the required affidavit attached hereto and incorporated herein. 24.4. Noncoercive Conduct Affidavit. Pursuant to Section 787.06, Florida Statutes, a nongovernmental entity executing, renewing, or extending a contract with a governmental entity is required to provide an affidavit, signed by an officer or a representative of the nongovernmental entity under penalty of perjury, attesting that the nongovernmental entity does not use coercion for labor or services as defined in Section 787.06(2)(a), Florida Statutes. By entering into this Agreement, the Consultant acknowledges that it has 58 of 92 576 read Section 787.06, Florida Statutes, and will comply with the requirements therein, and has executed the required affidavit attached hereto and incorporated herein. 24.5. Prohibition on Contracting with Entities of Foreign Concern. Pursuant to Section 287.138, Florida Statutes (which is expressly incorporated herein by reference), a governmental entity may not knowingly enter into a contract with an entity which would give access to an individual’s personal identifying information if (a) the entity is owned by the government of a foreign country of concern; (b) the government of a foreign country of concern has a controlling interest in the entity; or (c) the entity is organized under the laws of or has its principal place of business in a foreign country of concern. By entering into this Agreement, the Consultant acknowledges that it has read Section 287.138, Florida Statutes, and complies with the requirements therein, and has executed the required affidavit attached hereto and incorporated herein. 25.Counterparts. This Agreement may be executed in several counterparts, each of which shall be deemed an original and such counterparts shall constitute one and the same instrument. 26.Conflicts. In the event of a conflict between the terms of this Agreement and any exhibits or attachments hereto, the terms of this Agreement shall control. [Remainder of page intentionally left blank. Signature page and E-Verify Affidavit follows.] 59 of 92 577 578 E-VERIFY AFFIDAVIT In accordance with Section 448.095,Florida Statutes,the City requires all contractors doing business with the City to register with and use the E-Verify system to verify the work authorization status of all newly hired employees. The City will not enter into a contract unless each party to the contract registers with and uses the E-Verify system. The contracting entity must provide of its proof of enrollment in E-Verify.For instructions on how to provide proof of the contracting entity's participation/enrollment in E-Verify.please visit:https://www.e- verify.gov/faq/how-do-i-provide-proof-ot-my-participationenrollment-in-e-verify By signing below,the contracting entity acknowledges that it has read Section 448.095.Florida Statutes and will comply with the E-Verify requirements imposed by it,including but not limited to obtaining E-Verify affidavits from subcontractors. EfCheck here to confirm proof of enrollment in E-Verify has been attached to this Affidavit. Witness #2 Print Name:Entity Name:_ ACKNOWLEDGMENT State of Florida County of The foregoing instrument was acknowledged before me by means of l&physical presence or online notarization, this 22 day of ,20 '25",bv^AAJ C*4^0 CO i7 (name of person) as (type of authority)foriS^gRJtT (name of party on behalf of whom instrument is executed). Type as of Identification:t~C.J>-I— GUSTAVO A.HERRERA MY COMMISSION #HH 423473 EXPIRES:July 31,2027 Personallv known to me;or Produced identification (Tvpe Did take an oath;or Did not take an oath Notary Commissioned) 60 of 92 579 AFFIDAVIT ATTESTING TO NONCOERCIVE CONDUCT FOR LABOR OR SERVICES Effective July I.2024,Section 787.06.Florida Statutes,a nongovernmental entity executing,renewing, or extending a contract with a governmental entity is required to provide an affidavit,signed by an officer or a representative of the nongovernmental entity under penalty of perjury,attesting that the nongovernmental entity does not use coercion for labor or services as defined in Section 787.06(2)(a), Florida Statutes. By signing below.I hereby affirm under penalty of perjury'that: 1.I have read Section 787.06,Florida Statutes,and understand that this affidavit is provided in compliance with the requirement that,upon execution,renewal,or extension of a contract between a nongovernmental entity and a governmental entity,the nongovernmental entity must attest to the absence of coercion in labor or services. J .i, 2.I am an officer or representative of H ,a nongovernmental entity. 3.does not use coercion for labor or services as defined in the relevant section of the law. In the presence of: Witness #1 Print Name:A- Witness #2 Print Name:llcAJAj CUpUbi Under penalties of perjury,I declare that I have read the foregoing and the facts stated in it are true: Print Name:\/fkre v Title: Entity Name:S State of Florida County of LC<ALC< OATH OR AFFIRMATION Sworn to (or affirmed)and subscribed before me by means of 0 physical presence or online notarization,this 2-2,day of 0 AVUQfLy ,207 5~.by^UfW CAkuCo 2 GlCT- (name of person)as CXVrftJL-(type of authority)fof^Petlc^ (name of party on behalf of w'hom instrument is executed). Commissioned) /Personally known to me;or Produced identification (Type of Identification:v~<—) Did take an oath:or GUSTAVO A.HERRERA MY COMMISSION #HH 423473 EXPIRES:July 31,2027 Did not take an oath 61 of92 580 AFFIDAVIT REGARDING PROHIBITION ON CONTRACTING WITH ENTITIES OF FOREIGN COUNTRIES OF CONCERN Pursuant to Section 287.138,Florida Statutes (which is expressly incorporated herein by reference),a governmental entity may not knowingly enter into a contract with an entity which would give access to an individual’s personal identifying information if (a)the entity is owned by ethe government of a foreign country of concern;(b)the government of a foreign country of concern has a controlling interest in the entity;or (c)the entity is organized under the laws of or has its principal place of business in a foreign country of concern. This affidavit must be completed by an officer or representative of an entity submitting a bid.proposal,or reply to,or entering into,renewing,or extending,a contract with a governmental entity which would grant the entity access to an individual's personal identifying information. 1.("entity")does not meet any of the criteria in paragraphs (2)(a)-(c)of Section 287.138,F.S. In the presence of: Witness #2 Print Name:~ Under penalties of perjury,I declare that I have read the foregoing and the facts stated State of Florida County of Lu,PUx -bPP’C OATH OR AFFIRMATION Sworn to (or affirmed)and subscribed before me by means of physical presence or online notarization,this Tj-day of aHm ,20Z2T\by'St/^W CHkCtfO (name of person)as rxUNfcP-(type of authority')for (name of party on behalf of whom instrument is executed). (Print,Stam^.or Type asNotary Commissioned) GUSTAVO A.HERRERA MY COMMISSION #HH 423473 EXPIRES:July 31,2027 /Personally known to me;or Produced identification (Type of Identification:—) v Did take an oath;or Did not take an oath 62 of 92 IN WITNESS WHEREOF, the parties hereto have caused this Agreement to be executed the day and year as first stated above. CITY OF SOUTH MIAMI By: Genaro “Chip” Iglesias City Manager Attest: By: Nkenga “Nikki” Payne, CMC, FCRM City Clerk Approved as to form and legal sufficiency: By: Weiss Serota Helfman Cole & Bierman, P.L. City Attorney Addresses for Notice: Genaro “Chip” Iglesias City of South Miami Attn: City Manager 6130 Sunset Drive South Miami, FL 33143 305-668-2510 (telephone) 305-663-6345 (facsimile) chip@southmiamifl.gov (email) With a copy to: Weiss Serota Helfman Cole & Bierman, P.L. Attn: Lillian Arango, Esq. City of South Miami Attorney 2800 Ponce de Leon Boulevard, Suite 1200 Coral Gables, FL 33134 larango@wsh-law.com (email) CONSULTANT By: Name: Title: Entity: Addresses for Notice: (telephone) (facsimile) (email) With a copy to: (telephone) (facsimile) (email) 63 of 92 4380 SW 74th Ave Miami FL 33155 786-350-3958 ext 6414 bids@highmaintenanceservices.com PO BOX 144591 CORAL GABLES , FL 33114 581 582 ATTACHMENT B DECLARATION/AFFIDAVIT OF REPRESENTATION This affidavit is not required tor compliance with the City's Solicitation:however,it may be used to avoid the need to register members of your presentation team as lobbyists.Pursuant to City Ordinance 28-14-2206 (c)(9),any person who appears as a representative for an individual or firm for an oral presentation before a City certification,evaluation, selection,technical review,or similar committee,must list on an affidavit provided by the City staff,all individuals who may make a presentation.The affidavit must be filed by staff with the Clerk's office at the time the committee's proposal is submitted to the City Manager.For the purpose of this subsection only,the listed members of the presentation team,with the exception of any person otherwise required to register as a lobbyist,must not be required to pay any registration fees.No person may appear before any committee on behalf of an anyone unless he or she has been listed as part of the firm's presentation team pursuant to this paragraph or unless he or she is registered with the City Clerk's office as a lobbyist and has paid all applicable lobbyist registration fees. Pursuant to '92.525(2).Florida Statutes,the undersigned,,makes the following declaration under penalties of perjury: Listed below are all individuals who may make a presentation on behalf of the entity that the affiant represents in connection with Request for Proposals (RFP)No.. Please note:No person may appear before any committee on behalf of anyone unless he or she has been listed as part of the firm's presentation team pursuant to this paragraph or unless he or she is registered with the Clerk's office as a lobbyist and has paid all applicable lobbyist registration fees. NAME TITLE For the purpose of this Affidavit of Representation only,the listed members of the presentation team,with the exception of any person otherwise required to register as a lobbyist,will not be required to pay any registration fees. The Affidavit of Representation must be filed with the City Clerk's office at the time the committee's proposal is submitted to the City as part of the procurement process. Under penalties of perjury,I declare that 1 have read the foregoing declaration and that the facts stated in it are true and specifically that the persons listed above are the members of the presentation team of the entity listed below. STATE OF FLORIDA )ss: COUNTY OF Print Name The foregoing instrument was acknowledged before me by means of 0 physical presence or online notarization this 7-L day of 0 Ay O/W-4 ,20 L5~.by . on behalf of She/He is personally known to me or GFltas produced Cu -J)~L~ GUSTAVO A.HERRERAMYCOMMISSION#HH 423473 EXPIRES:July 31,2027 64 of 92 ATTACHMENT C “Janitorial Service Locations Matrix,” 65 of 92 583 LOCATION LOBBY/FLOO RS (SF)FLOOR TYPE OFFICE SPACE (SF)FLOOR TYPE RESTROOMS APPLIANCES MIRROWAVE, TOASTER, REFRIGERATOR, STOVE WINDOWS WATER FOUNTAIN SYLVA MARTIN & PORCH 573 Porch & Back Storage Area - Concrete 3,578 Main Office: Terrazo Floor; Kitchen: Linoleum; Bathroom: Tile 2 6 6 1 CITY HALL 2,840 Ceramic Tile in Lobby and Main Areas. Carpet in the Chambers 4,683 Carpet in all office areas (8) & Conference Room 4 10 66 3 POLICE 2,730 Entrance & Hallways: Tile & Linoleum 3,845 Offices: Linoleum & Tile Bathrooms: Tile/Holding Cells: Concrete; Storage Area: Concrete; Upstair Office: Carpet & Linoluem 8 with Showers 18 69 4 Note: The measurements and S.F. are estimated. SINKS & COUNTERS 3s - 1 c 9s -2c 1s - 3c 66 of 92 584 LOCATION LOBBY/FLOO RS (SF)FLOOR TYPE OFFICE SPACE (SF)FLOOR TYPE RESTROOMS APPLIANCES MIRROWAVE, TOASTER, REFRIGERATOR, STOVE WINDOWS WATER FOUNTAIN SINKS & COUNTERS 3s - 1 c COMMUNITY CENTER, including (Fitness Center & Cardio Room, Multi-Purpose Room, Arts & Crafts, Computer Lab & Education Room) 11,583 Tile throughout Community Center & restrooms. Carpet in Director's office. Rolled rubber flooring in Fitnes Center and upstairs common areas. Area rugs throughout Community Center. 11,027 Tile throughout Community Center & restrooms. Carpet in Director's office. Rolled rubber flooring in Fitnes Center and upstairs common areas. Area rugs throughout Community Center. 4 with Showers 3 172 8 Indoor Basketball Gymnasium & Bleachers 8,394 Hardwood Basketball floor.0 0 0 0 0 0 0 14s - 2c 67 of 92 585 LOCATION LOBBY/FLOO RS (SF)FLOOR TYPE OFFICE SPACE (SF)FLOOR TYPE RESTROOMS APPLIANCES MIRROWAVE, TOASTER, REFRIGERATOR, STOVE WINDOWS WATER FOUNTAIN SINKS & COUNTERS 3s - 1 c MOBLEY BUILDING 6,408 Carpet in common areas of Bay/Suite #1. Tile throughout remainder of Mobley Building. 3,126 Offices: Linoleum & Tile Bathrooms: Tile/Holding Cells: Concrete; Storage Area: Concrete; Upstair Office: Carpet & Linoluem 6 1 50 8 PUBLIC WORKS 674 Main Entrance: Tile 1,277 Offices: Tile & Carpet; Bathrooms: Tile; Breakroom: Tile; Motor Pool: Tile 3 with Showers 2 10 2 Dante Fascell Park 700 Restroom & Office Facility 700 Cerenic Tile Men - I Urinal; 1 ADA Stall. Women - 3 Stalls, 1 ADA. 0 2s - 1c 1 SR. CITIZEN CENTER 2,860 Tile throughout Senior Center. 40 Tile throughout Senior Center. 0 2 1-City. Balance County County SERVICES REQUIRED: Frequency Monday – Friday 6PM – 10PM City Hall: Departmental Offices, Human Resources, break rooms & Commission Chamber. * *Commission Chambers must be cleaned twice on Commission Meeting Days. Location(s) N/A 5s - 1c 1s - 1c 68 of 92 586 LOCATION LOBBY/FLOO RS (SF)FLOOR TYPE OFFICE SPACE (SF)FLOOR TYPE RESTROOMS APPLIANCES MIRROWAVE, TOASTER, REFRIGERATOR, STOVE WINDOWS WATER FOUNTAIN SINKS & COUNTERS 3s - 1 c Monday – Friday 7AM – 4PM Monday – Friday 6AM – 12 PM Monday -Friday 6 AM TO 12 PM Monday-Friday Dante Fascell Park 6 AM to 7: 30 AM Monday - Friday 12 PM to 4 PM Monday – Friday 12:30PM – 4PM Mobley Building – ALL RESTROOMS AND COMMON/LOBBY AREAS Senior Center Police Department, Sylva Martin Building, Public Works & Motor Pool. Community Center & Fitness Center (Includes Multi-Purpose Room, Art & Crafts, Computer Lab & Education Room) Indoor Basketball Gymnasium/Bleachers 69 of 92 587 ATTACHMENT D “Photographs of Floor Types in Service Areas” 70 of 92 588 City of South Miami City Hall & Sylva Martin Building Maintenance Areas City Hall 6130 Sunset Drive Lobby and Hallways Downstairs Men’s Bathrooms Downstairs Women’s Bathroom 71 of 92 589 Downstairs Unisex Bathroom Commission Chambers City Manager’s Office (3 offices, 1 Conference Room & 1 Small Bathroom) Finance Department (Entrance, 2 Offices, 2 Shared Office Spaces) 72 of 92 590 City Clerk’s Office Deputy City Clerk’s Office (2 Offices) Mayor and Commissioner’s Office Upstairs Entrance 73 of 92 591 Upstairs Men’s Bathroom Upstairs Women’s Bathroom IT Office Parking Enforcement Office Human Resource (2 Offices & 1 shared office space) 74 of 92 592 Sylva Martin Building 6130 Sunset Drive Entrance & Halls Code Enforcement Shared Office Space Conference Room & Kitchen Area Planning and Zoning Offices (2 Offices & 1 Shared Office Space) Building Department Offices (1 Office & 1 Shared Office Space) 75 of 92 593 Men’s Bathroom Women’s Bathroom 76 of 92 594 Police Department Maintenance Areas Police Department 6130 Sunset Drive Entrance / Hallways / Kitchen Communications Area (1 Shared Office Space) Downstairs Offices (4 Offices & 1 Conference Room) 77 of 92 595 Men’s Bathrooms Women’s Bathroom Cells Storage Area Upstairs Hallways 78 of 92 596 Upstairs Office’s (5 Offices & 2 Shared Office Spaces) 79 of 92 597 Upstairs Men’s Bathroom Upstairs Women’s Bathroom 80 of 92 598 Parks and Recreation Department Maintenance Areas Gibson-Bethel Community Center 5800 SW 66th Street Entrance and Lobby Administration Office Downstairs Hallways Downstairs Bathrooms Men 81 of 92 599 Women Kitchen Area Upstairs Hallways Upstairs Bathrooms Men Women 82 of 92 600 Fitness Center Directors Office Mobley Building 5825 SW 68th Street Suite 100 – 400 Suite 100: Hallway & Bathroom Suite 200: Hallway & Bathroom 83 of 92 601 Suite 300: Entrance & Bathroom Suite 400: Entrance, Offices, Hallway, Bathrooms South Miami Senior Center 6701 SW 62nd Avenue Office, Lunchroom, Kitchen 84 of 92 602 Public Works Department Maintenance Areas Public Works 4795 SW 75th Avenue Public Works Entrance Public Work Office (2 Shared Office Spaces & 1 Office) Bathroom & Kitchen Area Engineering Office (2 Offices) 85 of 92 603 Breakroom Men’s Bathroom Women’s Bathroom Motor Pool Office 86 of 92 604 ATTACHMENT E BACKGROUND SCREENING CHAPTER 435, FLORIDA STATUTES 435.04 87 of 92 605 Title XXXILABOR Chapter 435 EMPLOYMENT SCREENING SECTION 04 Level 2 screening standards. 435.04 Level 2 screening standards.— (1)(a) All employees required by law to be screened under this section and persons with an affiliation with a qualified entity for whom the qualified entity chooses to conduct screening under s. 943.0542 must undergo security background investigations as a condition of employment and continued employment which includes, but is not limited to, fingerprinting for statewide criminal history records checks through the Department of Law Enforcement, national criminal history records checks through the Federal Bureau of Investigation, and local criminal records checks through local law enforcement agencies. A security background investigation under this section also includes a search of the sexual predator and sexual offender registries of any state in which the current or prospective employee resided during the immediate preceding 5 years. (b) Fingerprints submitted pursuant to this section must be submitted electronically to the Department of Law Enforcement. (c) An agency may contract with one or more vendors to perform all or part of the electronic fingerprinting pursuant to this section. Such contracts must ensure that the owners and personnel of the vendor performing the electronic fingerprinting are qualified and will ensure the integrity and security of all personal information. (d) Vendors who submit fingerprints on behalf of employers must: 1. Meet the requirements of s. 943.053; and 2. Have the ability to communicate electronically with the state agency accepting screening results from the Department of Law Enforcement and provide the applicant’s full first name, middle initial, and last name; social security number or individual taxpayer identification number; date of birth; mailing address; sex; and race. (2) The security background investigations under this section must ensure that persons subject to this section have not been arrested for and are awaiting final disposition of; have not been found guilty of, regardless of adjudication, or entered a plea of nolo contendere or guilty to; or have not been adjudicated delinquent and the record has not been sealed or expunged for, any offense prohibited under any of the following provisions of state law or similar law of another jurisdiction: (a) Section 39.205, relating to the failure to report child abuse, abandonment, or neglect. (b) Section 393.135, relating to sexual misconduct with certain developmentally disabled clients and reporting of such sexual misconduct. (c) Section 394.4593, relating to sexual misconduct with certain mental health patients and reporting of such sexual misconduct. (d) Section 414.39, relating to fraud, if the offense was a felony. (e) Section 415.111, relating to adult abuse, neglect, or exploitation of aged persons or disabled adults. (f) Section 777.04, relating to attempts, solicitation, and conspiracy to commit an offense listed in this subsection. (g) Section 782.04, relating to murder. 88 of 92 606 (h) Section 782.07, relating to manslaughter, aggravated manslaughter of an elderly person or disabled adult, or aggravated manslaughter of a child. (i) Section 782.071, relating to vehicular homicide. (j) Section 782.09, relating to killing of an unborn child by injury to the mother. (k) Chapter 784, relating to assault, battery, and culpable negligence, if the offense was a felony. (l) Section 784.011, relating to assault, if the victim of the offense was a minor. (m) Section 784.021, relating to aggravated assault. (n) Section 784.03, relating to battery, if the victim of the offense was a minor. (o) Section 784.045, relating to aggravated battery. (p) Section 784.075, relating to battery on staff of a detention or commitment facility or on a juvenile probation officer. (q) Section 787.01, relating to kidnapping. (r) Section 787.02, relating to false imprisonment. (s) Section 787.025, relating to luring or enticing a child. (t) Section 787.04(2), relating to taking, enticing, or removing a child beyond the state limits with criminal intent pending custody proceedings. (u) Section 787.04(3), relating to carrying a child beyond the state lines with criminal intent to avoid producing a child at a custody hearing or delivering the child to the designated person. (v) Section 787.06, relating to human trafficking. (w) Section 787.07, relating to human smuggling. (x) Section 790.115(1), relating to exhibiting firearms or weapons within 1,000 feet of a school. (y) Section 790.115(2)(b), relating to possessing an electric weapon or device, destructive device, or other weapon on school property. (z) Section 794.011, relating to sexual battery. (aa) Former s. 794.041, relating to prohibited acts of persons in familial or custodial authority. (bb) Section 794.05, relating to unlawful sexual activity with certain minors. (cc) Section 794.08, relating to female genital mutilation. (dd) Chapter 796, relating to prostitution. (ee) Section 798.02, relating to lewd and lascivious behavior. (ff) Chapter 800, relating to lewdness and indecent exposure and offenses against students by authority figures. (gg) Section 806.01, relating to arson. (hh) Section 810.02, relating to burglary. (ii) Section 810.14, relating to voyeurism, if the offense is a felony. (jj) Section 810.145, relating to digital voyeurism, if the offense is a felony. (kk) Chapter 812, relating to theft, robbery, and related crimes, if the offense is a felony. (ll) Section 817.563, relating to fraudulent sale of controlled substances, only if the offense was a felony. (mm) Section 825.102, relating to abuse, aggravated abuse, or neglect of an elderly person or disabled adult. (nn) Section 825.1025, relating to lewd or lascivious offenses committed upon or in the presence of an elderly person or disabled adult. (oo) Section 825.103, relating to exploitation of an elderly person or disabled adult, if the offense was a felony. 89 of 92 607 (pp) Section 826.04, relating to incest. (qq) Section 827.03, relating to child abuse, aggravated child abuse, or neglect of a child. (rr) Section 827.04, relating to contributing to the delinquency or dependency of a child. (ss) Former s. 827.05, relating to negligent treatment of children. (tt) Section 827.071, relating to sexual performance by a child. (uu) Section 831.311, relating to the unlawful sale, manufacture, alteration, delivery, uttering, or possession of counterfeit-resistant prescription blanks for controlled substances. (vv) Section 836.10, relating to written or electronic threats to kill, do bodily injury, or conduct a mass shooting or an act of terrorism. (ww) Section 843.01, relating to resisting arrest with violence. (xx) Section 843.025, relating to depriving a law enforcement, correctional, or correctional probation officer means of protection or communication. (yy) Section 843.12, relating to aiding in an escape. (zz) Section 843.13, relating to aiding in the escape of juvenile inmates in correctional institutions. (aaa) Chapter 847, relating to obscene literature. (bbb) Section 859.01, relating to poisoning food or water. (ccc) Section 873.01, relating to the prohibition on the purchase or sale of human organs and tissue. (ddd) Section 874.05, relating to encouraging or recruiting another to join a criminal gang. (eee) Chapter 893, relating to drug abuse prevention and control, only if the offense was a felony or if any other person involved in the offense was a minor. (fff) Section 916.1075, relating to sexual misconduct with certain forensic clients and reporting of such sexual misconduct. (ggg) Section 944.35(3), relating to inflicting cruel or inhuman treatment on an inmate resulting in great bodily harm. (hhh) Section 944.40, relating to escape. (iii) Section 944.46, relating to harboring, concealing, or aiding an escaped prisoner. (jjj) Section 944.47, relating to introduction of contraband into a correctional facility. (kkk) Section 985.701, relating to sexual misconduct in juvenile justice programs. (lll) Section 985.711, relating to contraband introduced into detention facilities. (3) The security background investigations under this section must ensure that no person subject to this section has been arrested for and is awaiting final disposition of, been found guilty of, regardless of adjudication, or entered a plea of nolo contendere or guilty to, any offense that constitutes domestic violence as defined in s. 741.28, whether such act was committed in this state or in another jurisdiction. (4) For the purpose of screening applicability to participate in the Medicaid program, the security background investigations under this section must ensure that a person subject to screening under this section has not been arrested for and is not awaiting final disposition of; has not been found guilty of, regardless of adjudication, or entered a plea of nolo contendere or guilty to; and has not been adjudicated delinquent and the record sealed or expunged for, any of the following offenses: (a) Violation of a federal law or a law in any state which creates a criminal offense relating to: 1. The delivery of any goods or services under Medicaid or Medicare or any other public or private health care or health insurance program, including the performance of management or administrative services relating to the delivery of goods or services under any such program; 90 of 92 608 2. Neglect or abuse of a patient in connection with the delivery of any health care good or service; 3. Unlawful manufacture, distribution, prescription, or dispensing of a controlled substance; 4. Fraud, theft, embezzlement, breach of fiduciary responsibility, or other financial misconduct; 5. Moral turpitude, if punishable by imprisonment of a year or more; or 6. Interference with or obstruction of an investigation into any criminal offense identified in this subsection. (b) Violation of the following state laws or laws of another jurisdiction: 1. Section 817.569, criminal use of a public record or information contained in a public record; 2. Section 838.016, unlawful compensation or reward for official behavior; 3. Section 838.021, corruption by threat against a public servant; 4. Section 838.022, official misconduct; 5. Section 838.22, bid tampering; 6. Section 839.13, falsifying records; or 7. Section 839.26, misuse of confidential information. (c) Violation of a federal or state law, rule, or regulation governing the Florida Medicaid program or any other state Medicaid program, the Medicare program, or any other publicly funded federal or state health care or health insurance program. History.—s. 47, ch. 95-228; s. 16, ch. 96-268; s. 22, ch. 96-322; s. 4, ch. 98-417; s. 5, ch. 99-284; s. 88, ch. 2000-153; s. 7, ch. 2001-125; s. 5, ch. 2004-267; s. 4, ch. 2005-119; s. 111, ch. 2006- 120; s. 90, ch. 2006-197; s. 110, ch. 2007-5; s. 3, ch. 2007-112; s. 66, ch. 2009-223; s. 6, ch. 2010-31; s. 38, ch. 2010-114; s. 10, ch. 2012-73; s. 4, ch. 2013-80; s. 6, ch. 2014-84; s. 4, ch. 2014-194; s. 3, ch. 2016-162; s. 19, ch. 2017-37; s. 89, ch. 2018-24; s. 2, ch. 2023-220; s. 4, ch. 2024-132; s. 3, ch. 2024-243. TOP Privacy Policy | View Full Site Copyright © 2000-2024 State of Florid 91 of 92 609 END OF DOCUMENT 92 of 92 610 Page 1 of 43 1951 West Copans Road, Suite 2 Pompano Beach, FL 33064 Providing Unique Solutions to Suit Every Client’s Needs Since 1993 Proposal to City of South Miami RFP No. FN2024-17 Janitorial Services Proposal Manager: Tracy White, Director of Proposals and Corporate Communications Phone (866) 385-0672 Email: TWhite@Kleen-Tech.com 611 KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services Page 2 of 43 Table of Contents 1.7.1: Executive Summary 1.7.1.1: Cover Page ................................................................................ Page 1 1.7.1.2: Table of Contents ..................................................................... Page 2 1.7.1.3: Letter of Interest ........................................................................ Page 3 1.7.2: Proposal Form Package .............................................................. Page 4-31 Form 1. Proposal Form Package Acknowledgement Form 2A. Proposer’s Certification (if Company or Corporation) Form 3. Single Execution Affidavits Form 4. Dispute Disclosure Form 5. Certification Regarding Debarment, Suspension, & Other Responsibility Matters Primary Covered Transactions Form 6. Proposer’s Qualifications Survey Form 7. Price Proposal Form Form 8. Reference List and Attached Reference Letters (4) Form 9. Key Staff & Proposed Subcontractors Attachment B. Declaration/Affidavit of Representation 1.7.3: Proof of Experience ................................................................... Page 32-34 1.7.4: Previous Projects ........................................................................... Page 35 1.7.5: Proposer’s Qualifications .............................................................. Page 36 1.7.6: Personnel Qualifications/Key Staff .......................................... Page 37-39 1.7.7: Insurance Certificates ............................................................... Page 40-41 1.7.8: Additional Information .............................................................. Page 42-43 612 City of South Miami RFP No. FN2024-17, Janitorial Services Page 3 of 43 1.7.1 Letter of Interest City of South Miami January 23rd, 2025 6130 Sunset Drive City of South Miami, FL 33143 Attn: Steven P. Kulick, City of South Miami Chief Procurement Officer Re: RFP No. FN2024-17, Janitorial Services Dear Mr. Kulick and Representatives of the City of South Miami: Thank you for considering Kleen-Tech for Janitorial Services as specified in RFP No. FN2024-17. We appreciate your review of our proposal submission. As detailed throughout our proposal package, we have read and understand the specifications, terms and conditions detailed in the solicitation document and have submitted the required material to be considered fully responsive. Kleen-Tech, founded and headquartered in Denver, Colorado, is one of America’s leading janitorial companies. We currently have customers located throughout the United States and more than 1,800 employees servicing over 50 million square feet of commercial and government facilities. We have been providing custodial services since 1993 and some of our clients include the Cities of Lake Worth Beach, Boca Raton, and West Palm Beach, Florida. We understand the needs of government entities with multiple facilities that have unique needs and requirements. We also serve commercial clients with multiple campuses including Los Alamos National Laboratories in New Mexico, and Halliburton in Texas. Kleen-Tech has a long history of success adjusting our services to better align the needs of our clients and the full line of custodial services that we provide. We have crafted this proposal to address all of the City of South Miami’s requirements and plan to use our proven operational approach and wage rates to ensure dedicated responsiveness to you, the citizens of South Miami, and your visitors. We commit to accomplishing the custodial services outlined in the solicitation for janitorial services at the City of South Miami’s facilities with an orientation toward, and compliance with, all safety, environmental, and aesthetic issues and requirements. Kleen-Tech looks forward to developing a successful and longstanding partnership with the City of South Miami through the execution of this proposal. We look forward to performing these services for you and will ensure all tasks are completed to the highest standards of quality and professionalism. Sincerely, Jorge Saldana, Senior Vice President, Operations 613 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 4 OF 43 1.7.2.: Proposal Form Package 614 FORM 1 PROPOSAL FORM PACKAGE ACKNOWLEDGEMENTS I hereby propose to furnish the goods and services specified in the Request for Proposals,RFP No.FN2024-17.I agree that my Proposal will remain firm for a period of 180 days after opened by the City in order to allow the City adequate time to evaluate the Proposal. I certify that all information contained in this Proposal is truthful to the best of my knowledge and belief.I further certify that I am duly authorized to submit this Proposal on behalf of the Firm named as the Proposing Firm and that said Finn is ready,willing,and able to perfonn if awarded the Agreement. I further certify,under oath,that this Proposal is made without prior understanding,agreement, connection,discussion,or collusion with any other person,firm or corporation submitting a Proposal;no officer,employee or agent of the City of South Miami or any other Proposer has an interest in said Proposal.Furthermore,I certify that the undersigned executed this Proposal Form with full knowledge and understanding of matters therein contained and was duly authorized. I further certify that the Proposer acknowledges receipt of all Addenda issued by the City in connection with the RFP (Check the box next to each addendum received). X Addendum 1 Addendum 6 Addendum 2 Addendum 7 Addendum 3 Addendum 8 Addendum 4 Addendum 9 Addendum 5 Addendum 10 Attached hereto are the following forms/documents which form a part of this Proposal: Form 1. Form 2A. Form 2B. Form 3. Form 4. Form 5. Proposal Form Package Acknowledgement. Proposer’s Certification (if Company or Corporation) Proposer’s Certification (if Partnership) Single Execution Affidavits Dispute Disclosure Certification Regarding Debarment,Suspension,&Other Responsibility Matters Primary Covered Transactions Form 6. Form 7. Form 8. Form 9. Proposer’s Qualifications Survey Price Proposal Form Reference List Key Staff &Proposed Subcontractors KLEEN-TECH 27 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 5 OF 43 615 Docusign Envelope ID 1B3F3C01-0628-4ECF-9B56-F1344635C39B FORM 1 PROPOSAL FORM PACKAGE ACKNOWLEDGEMENTS (CONTINUED) Kleen-Tech Services,LLC NAM^PROPOSER firm Jawus UuljLam. SICVK A'lT'lu’-rdF PROPOSER James Vaughan,CEO NAME &TITLE,TYPED OR PRINTED MAILING ADDRESS 7100 Broadway,Suite 6-L Denver,CO 8022 1 (866)386-0672 TELEPHONE NUMBER State ofT-lurida County The foregoing instrument was acknowledged before me by means of Kleen-Tech Services.LLC (name of party on behalf of whom instrument is executed). Produced identification (Type of Identification: otary Public (Print,Stamp,or Type as Commissioned) physical presence or _ .,20,?C by James (type of authority)for online notarization,this15^ay of L/ZI fk/Vaughan (name of person)as CEO ' MONICA A STANARD-CATLETT NOTARY PUBLIC STATE OF COLORADO NOTARY ID 20134021139 MY COMMISSION EXPIRES 04/05/2025 Personally known to me;or Did take an oath;or Did not take an oath KLEEN-TECH 28 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 6 OF 43 616 Docusign Envelope ID:1B3F3C01-0628-4ECF-9B56-F1344635C39B FORM 2A PROPOSER’S CERTIFICATION (if Company or Corporation) CERTIFICATE STATE OF —Colorado ) )SS COUNTY OF Adams ) I HEREBY CERTIFY that a meeting of the Board of Directors of Kleen-Tech Services,LLC a corporation or company existing under the laws of the State of Delaware , held on 10/3/2019 ,the following resolution was duly passed and adopted: RESOLVED,that,as _James Vaughan of the Corporation/Company,be and is hereby authorized to execute the Proposal dated,1/23/25 ,to the City of South Miami for RFP No.FN2024-17 “Janitorial Services,”and that this execution thereof, attested by the Secretary of the Corporation/Company,and with the Corporate/ Company Seal affixed,shall be the official act and deed of this Corporation/Company. I further certify that said resolution is now in full force and effect. IN WITNESS WHEREOF,I have hereunto set my hand and affixed the official seal of corporation/company on this the of <\(Lt1U 024. KLEEN-TECH 29 of92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 7 OF 43 617 Docusign Envelope ID 1B3F3C01-0628-4ECF-9B56-F1344635C39B FORM 3 SINGLE EXECUTION AFFIDAVITS This form must resigned and sworn to in the presence of a notar>public OR other official authorized to administer oaths. THIS FORM COMBINES SEVERAL AFFIDAVIT STATEMENTS TO BE SWORN TO BY THE PROPOSER OR PROPOSER AND NOTARIZED BELOW.IN THE EVENT THE PROPOSER OR PROPOSER CANNOT SWEAR TO ANY OF THESE AFFIDAVIT STATEMENTS,THE PROPOSER OR PROPOSER IS DEEMED TO BE NON¬ RESPONSIBLE AND IS NOT ELIGIBLE TO SUBMIT A PROPOSAL/PROPOSAL. THESE SINGLE EXECUTION AFFIDAVITS ARE SUBMITTED TO THE CITY OF SOUTH MIAMI AND ARE STATEMENTS MADE: By:James Vaughan For (Name of Proposing or Bidding Entity):KJeen-Tech Services.LLC Whose business address is:7 1 00 Broadway.Suite 6-L.Denver,CO 8022 1 And (if applicable)its Federal Employer Identification Number (FEIN)is:83-4 1 73256 (if the entity does not have an FEIN,include the Social Security Number of the individual signing this sworn statement.SS#:) Americans with Disabilities Act Compliance Affidavit The above named firm,corporation or organization is in compliance with and agrees to continue to comply with,and assure that any subcontractor,or third party contractor under this project complies with all applicable requirements of the laws listed below including,but not limited to, those provisions pertaining to employment,provision of programs and services,transportation, communications,access to facilities,renovations,and new construction.•The American with Disabilities Act of 1990 (ADA),Pub.L.101-336,104 Stat 327,42 USC 1210112213 and 47 USC Sections 225 and 66 1 including Title I,Employment;Title II,Public Services;Title III,Public Accommodations and Services Operated by Private entities;Title IV,Telecommunications;and Title V,Miscellaneous Provisions. •The Florida Americans with Disabilities Accessibility Implementation Act of 1993, Section 553.501-553.513,Florida Statutes: •The Rehabilitation Act of 1973,229 USC Section 794; •The Federal Transit Act,as amended 49 USC Section 1612; •The Fair Housing Act as amended 42 USC Section 3601-363 1 . Proposer Initials KLEEN-TECH 31 of92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 8 OF 43 618 Docusign Envelope ID 1B3F3C01-0628-4ECF-9B56-F1344635C39B Public Entity Crimes Affidavit I understand that a “public entity crime”as defined in Paragraph 287.1 33(I)(g),Florida Statutes, means a violation of any state or federal law by a person with respect to and directly related to the transaction of business with any public entity or with an agency or political subdivision of any other state or of the United States,including but not limited to,any Proposal or contract for goods or services to be provided to any public entity or an agency or political subdivision of any other state or of the United States and involving antitrust,fraud,theft,bribery,collusion,racketeering, conspiracy,or material misrepresentations. I understand that “convicted”or “conviction”as defined in Paragraph 287.1 33(1)(b),Florida Statutes,means a finding of guilt or a conviction of a public entity crime,with or without an adjudication of guilt,in any federal or slate trial court of record relating to charges brought by indictment or information after July I,1989,as a result of a jury verdict,non-jury trial,or entry of a plea of guilty or nolo contendere. I understand that an “affiliate”as defined in Paragraph 287.1 33(I)(a),Florida Statutes,means: I.A predecessor or successor of a person convicted of a public entity crime;or 2.An entity under the control of any natural person who is active in the management of the entity and who has been convicted of a public entity crime.The term “affiliate”includes those officers, directors,executives,partners,shareholders,employees,members,and agents who are active in the management of an affiliate.The ownership by one person of shares constituting a controlling interest in another person,or a pooling of equipment or income among persons when not for fair market value under an arm's length agreement,shall be a prima facie case that one person controls another person.A person who knowingly enters into a joint venture with a person who has been convicted of a public entity crime in Florida during the preceding 36 months shall be considered an affiliate. 1 understand that a “person”as defined in Paragraph 287.1 33(I )(e),Florida Statutes,means any natural person or entity organized under the laws of any state or of the United States with the legal power to enter into a binding contract and which proposals or applies to Proposal on contracts for the provision of goods or services let by a public entity,or which otherwise transacts or applies to transact business with a public entity.The term “person”includes those officers,directors, executives,and partners,shareholders,employees,members,and agents who are active in management of an entity. Based on information and belief,the statement,which I have marked below,is true in relations to the entity submitting this sworn statement. (INDICATE WHICH STATEMENT APPLIES.) S Neither the entity submitting this sworn statement,nor any of its officers,directors, executives,partners,shareholders,employees,members,or agents who arc active in the management of the entity,nor any affiliate of the entity has been charged with ad convicted of a public entity crime subsequent to July I,1989. The entity submitting this sworn statement,or one or more of its officers,directors, executives,partners,shareholders,employees,members,or agents who are active in the 32 of 92 KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 9 OF 43 619 Docusign Envelope ID:1B3F3C01-0628-4ECF-9B56-F1344635C39B management of the entity,or an affiliate of the entity has been charged with and convicted of a public entity crime subsequent to July I,1989. The entity submitting this sworn statement,or one or more of its officers,directors, executives,partners,shareholders,employees,members,or agents who are active in the management of the entity,or an affiliate of the entity has been charged with and convicted of a public entity crime subsequent to July 1,1989.However,there has been a subsequent proceeding before a Hearing Officer of the State of Florida ,Division of Administrative Hearings and the final Order entered by the Hearing Officer determined that it was not in the public interest to place the entity submitting this sworn statement on the convicted vendor list (attach a copy of the final order). 1 understand that the submission of this form to the contracting officer for the public entity identified in paragraph 1 above is for that public entity only and that this form is valid through December 3 1 of the calendar year in which it is filed.I also understand that 1 am required to inform the public entity prior to entering into a contract in excess of the threshold amount provided in Section 287.017,Florida Statutes for category two of any change in the information contained in ihtsTorm. Proposer Initials No Conflict of Interest or Contingent Fee Affidavit Proposer warrants that neither it nor any principal,employee,agent,representative nor family member has paid or will pay any fee or consideration that is contingent on the award or execution of a contract arising out of this solicitation.Proposer also warrants that neither it nor any principal, employee,agent,representative nor family member has procured or attempted to procure this contract in violation of any of the provisions of the Miami-Dade County and City of South Miami conflict of interest or code of ethics ordinances.Further,Proposer acknowledges that any violation of these warrants will result in the termination of the contract and forfeiture of funds paid or to be -paid to the Proposer should the Proposer be selected for the performance of this contract. Proposer Initials Business Entity Affidavit Proposer hereby recognizes and certifies that no elected official,board member,or employee of the City of South Miami (the "City”)shall have a financial interest directly or indirectly in this transaction or any compensation to be paid under or through this transaction,and further,that no City employee,nor any elected or appointed officer (including City board members)of the City, nor any spouse,parent or child of such employee or elected or appointed officer of the City,may be a partner,officer,director or proprietor of Proposer or Vendor,and further,that no such City employee or elected or appointed officer,or the spouse,parent or child of any of them,alone or in combination,may have a material interest in the Vendor or Proposer.Material interest means direct or indirect ownership of more than 5%of the total assets or capital stock of the Proposer.Any exception to these above described restrictions must be expressly provided by applicable law or ordinance and be confirmed in writing by City.Further,Proposer recognizes that with respect to this transaction or Proposal,if any Proposer violates or is a party to a violation of the ethics 33 of 92 KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 10 OF 43 620 Docusign Envelope ID:1B3F3C01-0628-4ECF-9B56-F1344635C39B ordinances or rules of the City,the provisions of Miami-Dade County Code Section 2-11.1,as applicable to City,or the provisions of Chapter 1 12,part III,Fla.Stat.,the Code of Ethics for Public Officers and Employees,such Proposer may be disqualified from furnishing the goods or services for which the Proposal or Proposal is submitted and may be further disqualified from snbftiitting any future proposals or Proposal for goods or services to City. Proposer Initials Anti-Collusion Affidavit I .Proposer 'Proposer has personal knowledge of the matters set forth in its Proposal/Proposal and is fully informed respecting the preparation and contents of the attached Proposal/Proposal and all pertinent circumstances respecting the Proposal/Proposal; 2.The Proposal/Proposal is genuine and is not a collusive or sham Proposal/Proposal;and 3.Neither the Proposer/Proposer nor any of its officers,partners,owners,agents,representatives, employees,or parties in interest,including Affiant,has in any way colluded,conspired, connived,or agreed,directly or indirectly with any other Proposer/Proposer,firm,or person to submit a collusive or sham Proposal/Proposal,or has in any manner,directly or indirectly, sought by agreement or collusion or communication or conference with any other Proposer/Proposer,firm,or person to fix the price or prices in the attached Proposal/Proposal or of any other Proposer/Proposer,or to fix any overhead,profit,or cost element of the Proposal/Proposal price or the Proposal/Proposal price of any other Proposer/Proposer,or to secure through any collusion,conspiracy,connivance or unlawful agreement any advantage—o^gainst the City or any person interested in the proposed Contract. Proposer Initials Scrutinized Company Certification 1.Proposer certifies that it and its subcontractors are not on the Scrutinized Companies that Boycott Israel List.Pursuant to Section 287.135,F.S.,the City may immediately terminate the Agreement that may result from this RFP at its sole option if the Proposer or its subcontractors are found to have submitted a false certification;or if the Proposer,or its subcontractors are placed on the Scrutinized Companies that Boycott Israel List or is engaged in the boycott of Israel during the term of the Agreement. 2.If the Agreement that may result from this RFP is for more than one million dollars,the Proposer certifies that it and its subcontractors are also not on the Scrutinized Companies with Activities in Sudan,Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List,or engaged with business operations in Cuba or Syria as identified in Section 287.135,F.S.pursuant to Section 287.135,F.S.,the City may immediately terminate the Agreement that may result from this RFP at its sole option if the Proposer,its affiliates,or its subcontractors are found to have submitted a false certification;or if the Proposer,its affiliates, or its subcontractors are placed on the Scrutinized Companies with Activities in Sudan List,or 34 of 92 KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 11 OF 43 621 Docusign Envelope ID:1B3F3C01-0628-4ECF-9B56-F1344635C39B Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List,or engaged with business operations in Cuba or Syria during the term of the Agreement. 3.The Proposer agrees to observe the above requirements for applicable subcontracts entered into for the performance of work under the Agreement that may result from this RFP.As provided in Subsection 287.135(8),F.S.,if federal law ceases to authorize the above-stated contracting prohibitions then they shall become inoperative. x——DS[JV Proposer Initials Drug-Free Workplace Affidavit Proposer hereby recognizes that,pursuant to F.S.§287.087,preference shall be given to businesses with drug-free workplace programs when two proposals/Proposal are equal with respect to price,quality,and service.Proposer understands that in order to qualify as a drug-free workplace,Proposer must: a)Publish a statement notifying employees that the unlawful manufacture,distribution, dispensing,possession,or use of a controlled substance is prohibited in the workplace and specifying the actions that will be taken against employees for violations of such prohibition. b)Inform employees about the dangers of drug abuse in the workplace,the Proposer’s policy of maintaining a drug-free workplace,any available drug counseling,rehabilitation,and employee assistance programs,and the penalties that may be imposed upon employees for drug abuse violations. 1)Give each employee engaged in providing commodities or contractual services under the RFP a copy of the statement specified in subsection (1). 2)Notify employees that,as a condition of working on the commodities or contractual services under the RFP,the employee must abide by the terms of the statement and will notify the employer of any conviction of,or plea of guilty or nolo contendere to,any violation of chapter 893 or of any controlled substance law of the United States or any state,for a violation occurring in the workplace no later than five (5)days after such conviction. 3)Impose a sanction on,or require the satisfactory participation in a drug abuse assistance or rehabilitation program if such is available in the employee’s community,by any employee who is so convicted. 4)Make a good faith effort to continue to maintain a drug-free workplace through the implementation of this section. Based on information and belief,the statement,which I have marked below,is true in relations to the entity submitting this sworn statement. (INDICATE WHICH STATEMENT APPLIES.) S The entity submitting this sworn statement is a drug-free workplace and is in full 35 of 92 KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 12 OF 43 622 Docusign Envelope ID 1B3F3C01-0628-4ECF-9B56-F1344635C39B compliance with the requirements set forth under F.S.§287.087. zeros The entity submitting this sworn statement is not a drug-free workplace. Proposer Initials City Non-Discrimination Requirements Affidavit Proposer understands that pursuant to Section 3-1.1 of the Code of the City of South Miami,the City will not enter into or award a contract to an entity engaged in a boycott. Proposer understands that “Boycott”as defined under Section 3-1.1 of the Code of the City of South Miami means to blacklist,divest from,or otherwise refuse to deal with a nation or country, or to blacklist or otherwise refuse to deal with a person or entity when the action is based on race, color,national origin,religion,sex,gender identity,sexual orientation,marital or familial status, age,or disability in a discriminatory manner.The term boycott does not include a decision based upon business or economic reasons,or boycotts,embargoes,trade restrictions,or divestments that are specifically authorized or required by federal law or state law. Proposer certifies that it is not engaged in a boycott,and is in full compliance with Section 3-1.1 <ef4he Code of the City of South Miami. JI/ Proposer Initials Acknowledgment,Warranty,and Acceptance 1.Contractor warrants that it is willing and able to comply with all applicable state of Florida laws,rules and regulations. 2.Contractor warrants that it has read,understands,and is willing to comply with all requirements of RFP No.FN2024-03 and any addendum/addenda related thereto. 3.Contractor warrants that it will not delegate or subcontract its responsibilities under an agreement without the prior written permission of the City Commission or City Manager,as applicable. 4.Contractor warrants that all information provided by it in connection with this Proposal is true (°Snd_accurate.Le Proposer Initials [REMAINDER OF PAGE LEFT INTENTIONALLY BLANK. SIGNATURE PAGE FOLLOWS.] KLEEN-TECH 36 oT92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 13 OF 43 623 Docusign Envelope ID:1B3F3C01-0628-4ECF-9B56-F1344635C39B In .the,presence of: Anthony Firestine Trarv Uhl boWitness#2 Print Name:Tracy Wh1te §igS£fla^ed and d^«vered by: '32JBIIBPOIIUPI —Print Name:James Vaughan Title:CEO State of Flerida 0 County of ACKNOWLEDGMENT The foregoing instrument was acknowledged before me by means of physical presence or _ online notarization,this /5?^idav of CJ ,20^$?bv James Vaughan (name of person)as CEO !(type of authority)for Kleen-Tech Services,LLC (name of party on behalf of whom instrument is executed). MONICAA.STANARD-CATLETT NOTARY PUBLIC STATE OF COLORADO NOTARY ID 20134021139IMYCOMMISSIONEXPIRES04/05/2025 /Personally known to me;or Public (Print,Stamp,or Type as Commissioned) Produced identification (Type of Identification: ) Did take an oath;or Did not take an oath KLEEN-TECH 37 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 14 OF 43 624 Docusign Envelope ID 1B3F3C01-0628-4ECF-9B56-F1344635C39B FORM 4 DISPUTE DISCLOSURE Answer the following questions by placing an “X”after “Yes”or “No”.If you answer “Yes”, please explain in the space provided,or on a separate sheet attached to this form. 1.Has your firm or any of its officers,received a reprimand of any nature or been suspended by the Department of Professional Regulations or any other regulatory agency or professional associations within the last five (5)years? YES NO X 2.Has your firm,or any member of your firm,been declared in default,terminated or removed from a contract or job related to the services your firm provides in the regular course of business within the last five (5)years? YES NO X 3.Has your firm had against it or filed any requests for equitable adjustment,contract claims. Proposal protests,or litigation in the past five (5)years that is related to the services your firm provides in the regular course of business? YES NO X If yes,state the nature of the request for equitable adjustment,contract claim,litigation,or protest, and state a brief description of the case,the outcome or status of the suit and the monetary amounts of extended contract time involved. I hereby certify that all statements made are true and agree and understand that any misstatement or misrepresentation of falsification of facts shall be cause for forfeiture of rights for further consideration of this Proposal or Proposal for the City of South Miami. Stale County of J J Q j/d /~ ACKNOWLEDGMENT The foregoing instrument was acknowledged before me by means of physical presence or dl online notarization, this l^i of CYTmIMZI ft-/,20tjXT".by James Vaughan (name of person) as CEO /(type of authority)for Kleen-Tech Services,LLC (name of party nn behalf of whom instrument is executed).MONICAA STANARD-CATLETTNOTARYPUBLICSTATEOFCOLORADONOTARYID20134021139|MY COMMISSION EXPIRES 04/05/2025PCPersonallyknowntome;or Commissioned) Produced identification (Type of Identification:) Did take an oath;or Did not take an oath KLEEN-TECH 38 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 15 OF 43 625 Docuslgn Envelope ID:1B3F3C01-062B-4ECF-9B56-F1344635C39B FORMS CERTIFICATION REGARDING DEBARMENT,SUSPENSION,AND OTHER RESPONSIBILITY MATTERS PRIMARY COVERED TRANSACTIONS This certification is required by the regulations implementing Executive Order 12549,Debarment and Suspension,13 CFR Part 145.The regulations were published as Part VII of the May 26,1988 Federal Register (pages 19160-1921 1).Copies of the regulations are available from local offices of the U.S.Small Business Administration. (I)The prospective primary participant certifies to the best of its knowledge and belief that it and its principals: (a)Are not presently debarred,suspended,proposed for disbarment,declared ineligible,or voluntarily excluded from covered transactions by any Federal department or agency; (b)Have not within a three-year period preceding this application been convicted of or had a civil judgment rendered against them for commission of fraud or a criminal offense in connection with obtaining,attempting to obtain,or performing a public (Federal,State,or local)transaction or contract under a public transaction; violation of Federal or State antitrust statutes or commission of embezzlement, theft,forgery,bribery,falsification or destruction of records,making false statements,or receiving stolen property; (c)Are not presently indicted for or otherwise criminally or civilly charged by a governmental entity (Federal,State,or local)with commission of any of the offenses enumerated in paragraph (l)(b)of this certification;and (d)Have not within a three-year period preceding this application had one or more public transactions (Federal,State,or local)terminated for cause or default. (2)Where the prospective primary participant is unable to certify to any of the statements in this certification,such prospective primary participant shall attach an explanation to this Statement of Qualifications. B usiness N ame Kleen-Tech Services,LLC f—DocuSlgn«d by Date 1/14/2025 Bv.J '—525uirercgrrari Signature of Authorized Representative James Vaughan,CEO Name and Title of Authorized Representative KLEEN-TECH 39 of92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 16 OF 43 626 FORM 6 PROPOSER’S QUALIFICATIONS SURVEY COMPANY QUALIFICATIONS QUESTIONNAIRE Please complete this Company Qualifications Questionnaire.By completing this form and submitting a response to the RFP,you certify that any and all information contained in the Proposal is true,that your response to the RFP is made without prior understanding,agreement,or connections with any corporation,finn or person submitting a response to the RFP for the same materials,supplies,equipment,or services,is in all respects fair and without collusion or fraud, that you agree to abide by all terms and conditions of the RFP,and certify that you are authorized to sign for the Proposer’s firm. Some responses may require the inclusion of separate attachments.Separate attachments should be as concise as possible,while including the requested information.In no event should the total page count of all attachments to this Form exceed five (5)pages.Some information may not be applicable;in such instances,please insert “N/A”. Kleen-Tech Services,LLC Finn Name 7100 Broadway,Suite 6-L,Denver,CO 80221 Principal Business Address (866)385-0672 (303)428-2083 Telephone Number Facsimile Number TWhite@Kleen-Tech.com Email Address 83-417325 Federal I.D.No.or Social Security Number 2015085320 Municipal Business Tax/Occupational License No. FIRM HISTORY AND INFORMATION How many years has the firm has been in business under its current name and ownership?32 Kleen-Tech is a whole subsidiary of Concierge Building Services,LLC.In 2019,Kleen-Tech underwent a change of ownership and organizational structure. Please identify the Firm’s document number with the Florida Division of Corporations and date the Finn registered/filed to conduct business in the State of Florida: M20000008035 11/5/2020 Document Number Date Filed Please identify the Firm's category with the Florida Department of Business Professional Regulation (DBPR),DBPR license number,and date licensed by DBPR: N/A Category License No.Date Licensed KLEEN-TECH 40 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 17 OF 43 627 Please indicate the type of entity form of the Finn (if other,please describe): Individual Partnership Corporation is LLC LLP Other Please identify the Finn’s primary business:Custodial Services Please identify the number of continuous years your Firm has performed its primary business:32 Please list all professional licenses and certifications held by the Finn,its Qualifier/Principal,and any Key Staff,including any active certifications of small,minority,or disadvantaged business enterprise,and the name of the entity that issued the license or certification: License/Certification Type Name of Entity Issuing License or Certification License No.License Issuance Date Certificate of Status State of Florida M20000008035 9/11/2020 Please identify the name,license number,and issuance date of any prior companies that pertain to your Firm: License/Certification Type Name of Entity Issuing License or Certification License No.License Issuance Date N/A Please identify all individuals authorized to sign for the entity,their title,and the threshold/level of their signing authority: Authorized Signor’s Name Title Signing Authority Threshold (All.Cost up to $X-Amount,No Cost,Other) Anthony Maglia VP Cost up to $250k James Vaughan CEO All Jorge Saldana VP Cost up to $2 50k Please identify the total number of Finn employees,managerial/administrative employees,and identify the total number of trades employees by trade (e.g.,20 electricians,5 laborers,2 mechanics,etc.): INSURANCE INFORMATION Please provide the following information about the Firm’s insurance company: Total No.of Employees 2.145 Total No.of Managerial/Administrative Employees 201 Total No.of Trades Employees by Trade 1.944 service/field workers IMA Tina Hackett Insurance Carrier Name Insurance Carrier Contact Person KLEEN-TECH 41 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 18 OF 43 628 Docusign Envelope ID:1B3F3CO1-0628-4ECF-9B56-F1344635C39B 1705 17th St,Suite 100 Denver,CO 80221 (303)534-4567 Insurance Carrier Address Telephone No. tina.hackett@imacorp.com Email Has the Firm filed any insurance claims in the last five (5)years?No K Yes If yes,please identify the type of claim and the amount paid out under the claim:confidential FIRM OWNERSHIP Please identify all Firm owners or partners,their title,and percent of ownership: Owner/Partner Name Title Ownership (%) Concierge Building Services,LLC Parent company 100% Please identify whether any of the owners/partners identified above are owners/partners in another entity: MNo Yes If yes,please identify the name of the owner/partner,the other entity’s name,and percent of ownership held by the stated owner/partner: Owner/Partner Name Other Entity Name Ownership (%) N/A RECENT CONTRACTS Please identify the five (5)most recent contracts in which your Firm has provided services to other public entities: Public Entity Name Contact Person Telephone No.Email Address Date Awarded City of Lake Worth Beach Phil Johnson 561-719-5291 pwjohnSOh ^lalieworthhcnchfl pnv 2021 City of Boca Raton Diahanne M.Wong 561-4 16-385)dmwonggmyboca us 2/1/24 City of West Palm Beach James Looney 561-246-7240 jlooney#wpb.org 2023 City of Plymouth,MN Amy Hanson 763-509-5526 aplymouthmn gov 1/1/21 City of Marble Falls,TX Tony Kelly 830-265-7408 tkellyramarblefallstx gov I0/6Z2I By signing below,Proposer certifies that the information contained herein is complete and accurate to the best of Proposer’s knowledge. p;rm-Kleen-Tech Services,LLC ,Oec.MOtgngd by Authorized Signature:Date:1/14/2025 Print or Type Name;James Vaughan Title:CEO KLEEN-TECH 42 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 19 OF 43 629 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services,Section 3. NOTE:OVER THE TERM OF THE AGREEMENT,THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS,DEPENDING UPON CONDITIONS.IN THOSE CASES,THE ANNUAL FEE WILL BE ADJUSTED USING THE “SCHEDULE OF VALUES”MATRIX BELOW. A.ANNUAL FEE YEAR ANNUAL FEE Year 1 $155,704 Year 2 $163,489 Year 3 $171,663 Year 4 (Option Year)$180,246 Year 5 (Option Year)$189.258 TOTAL $860,360 B.SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch;City Hall (1st &2nd Floor);Police Department (1st & 2nd Floor) Year 1:$31,079 Year 2:$32,633 Year 3:$34,265 Year 4:$35,978 $Year 5:$37,777 Community Center (Multi-Purpose, Arts &Crafts Computer Lab & Education Room) Year 1:$52,284 Year 2:$54,898 Year 3:$57,643 Year 4:$60,525 $Year 5:$63,551 Indoor Basketball Gymnasium /Bleachers Year 1:$20,370 Year 4:$23,581 Year 2:$21,389 Year 5:$24,760 $Year 3:$22,458 Marshall Williamson building, commonly known as Mobley building Year 1:$21,817 Year 4:$25,256 Year 2:$22,907 Year 5:$26,519 $Year 3:$24,053 KLEEN-TECH 43 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 20 OF 43 630 Docusign Envelope ID:1BBE81A0-8587-48C8-8E14-3D5149BEF529 Senior Citizens Center Year 1:$11,582 Year 4:$13,407 Year 2:$12,161 Year 5:$14,077 $Year 3:$12,769 Public Works Year 1:$9,617 Year 4:$1 1.133 Year 2:$10,098 Year 5:$1 1.690 $Year 3:$10,603 Dante Fascell Park Year 1:$8,956 Year 4:$10,367 Year 2:$9,403 Year 5:$10,885 $Year 3:$9,873 Firm-Kleen-Tech Sendees,LLC1111*1•—nnmuSignad-hy: Authorized Signature:°'S25011BFC3114F1... Print or Type Name:-Tames Vaughan Date:^2025 Title:CEO KLEEN-TECH 44 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 21 OF 43 631 FORM 8 REFERENCE LIST IN ADDITION TO THE INFORMATION REQUIRED ON THIS FORM, PROPOSER SHALL PROVIDE A MINIMUM OF FOUR (4)REFERENCE LETTERS. REFERENCE #1 Public Entity Name:City of Lubbock Reference Contact Person/Title/Department:T.J.(Tommy)Carpenter Assistant Director of Facilities Management Contact Number &Email Phone:806-775-2200 Email:tcarpenter@mylubbock.us Public Entity Size/Number of Residents/Square Mileage:588.703 square feet/49 facilities Residents:266,878 Square Mileage:123.6 mi Event(s)Completed (include Name of Project/Event,Date of Event Start/Completion,Details on Size/Scope of Work/Complexity)Kleen-Tech has enjoy ed a longstanding partnership with the City of Lubbock,Texas.Our current agreement,which has been in place since January 2019 includes janitorial,floor care,and Day Porter services for 49 of the City’s facilities including community and recreation centers,police facilities,and water treatment locations,among others. Is the Contract still Active?Yes X No KLEEN-TECH 45 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 22 OF 43 632 Kleen-Tech Services,LLC has been performing janitorial,floor care,and Day Porter services for the City of Lubbock since 2019 and previously served our facilities from 2008 to 2014.Kleen-Tech has performed janitorial services to numerous City buildings including community and recreation centers,police facilities,and water treatment locations,among others. Kleen-Tech is responsive to our needs,and does a very good job in cleaning,reporting,and being a reliable company with an excellent work ethic.I highly recommend them to clean for the City of San Antonio,Texas. Sincerely, Tommy Carpenter Director of Facilities Management (806)319-0814 tcarpenter@mylubbock.us KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 23 OF 43 633 REFERENCE #2 Public Entity Name:Harris County,TN,Region 3 Reference Contact Person/Title/Department:Amber Seastrunk,Business Services Manager Contact Number &Email Phone:832-541-9611 Email:Amber.Seastrunk@fpm.hctx.net Public Entity Size/Number of Residents/Square Mileage:600,000 square feet 13 facilities Population:4,835,125 Square Mileage:1,777 mi Event(s)Completed (include Name of Project/Event,Date of Event Start/Completion,Details on Size/Scope of Work/Complexity)Kleen-Tech has provided janitorial,floor care,and day porter services for Harris County’s Region 3 facilities since 2015.This contract includes 13 facilities with more than 600,000 square feet of space serviced nightly. Is the Contract still Active?Yes No KLEEN-TECH 46 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 24 OF 43 634 HARRIS COUNTY 1111 Fannin Street,8‘h Floor Houston,Texas 77002 (832)713-0643 To Whom it May Concern, Kleen-Tech has been performing janitorial services at Harris County since December 2015.Kleen-Tech is always very responsive to our needs and we appreciate their service,transparency,and reliability.I highly recommend them for janitorial services wherever you may need them. Sincerely, Eduardo Paredes Contract Administrator |Building Operations Services KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 25 OF 43 635 REFERENCE #3 Public Entity Name:Jefferson County,CO Reference Contact Person/Title/Department:Corey Lanham,Campus Services Supervisor Contact Number &Email Phone:303-271-6058 Email:CLanham@jeffco.us Public Entity Size/Number of Residents/Square Mileage:947,687 square feet/22 facilities Population:576,366 Square Mileage:778 mi Event(s)Completed (include Name of Project/Event,Date of Event Start/Completion,Details on Size/Scope of Work/Complexity)Kleen-Tech is proud to have a longstanding partnership with Jefferson County,Colorado since 2017.As the provider of services at Jefferson County’s 22 municipal facilities,we have demonstrated our ability to successfully perform and provide services that meet or exceed our customer's expectations. Is the Contract still Active?Yes No KLEEN-TECH 47 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 26 OF 43 636 Facilities ManagementJEFFERSSN COUNTY COLORADO To Whom It May Coi^cer^ Please accept this Letter as a recommendation -for Kleen-Tech services Corporation.Kleen-Tech provides janitorial and -floorcareservices-for o\JtY^00,000 square feet of space throixghoix.t Jefferson County's 22 municipal facilities. we are very pleased with the level of service and quality delivered by Kleen-rech and highly recommend them for services. Sincerely, Corey Lanham Campizs services Supervisor Facilities Management Jefferson County y-00Jefferson Cotxnty Parkway,Sizlte 300 golden,co 2*2421 0 323.271.62S? C 722.632.3224 Facilities Helpdesk.323.271.s222 cla nham@jeffco.ix-S JEFFERSSNlFacilities county cot.orado |Management KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 27 OF 43 637 REFERENCE #4 Public Entity Name:Halliburton Energy Services,Inc. Reference Contact Person/Title/Department:Josh Rogers.Property Manager Contact Number &Email Phone:713-689-9473 Email:Joshua.Rogers@halliburton.com Public Entity Size/Number of Residents/Square Mileage:3.023.033 square teet 35 buildings Event(s)Completed (include Name of Project/Event,Date of Event Start/Completion,Details on Size/ Scope of Work/Complexity)Kleen-Tech provides full service janitorial.Dav Porter,and floor care services at Halliburton’s Houston-area Headquarters,executive oil,research,lab,and testing facilities. Kleen-Tech views its 20+year relationship with Halliburton as a partnership,through which we work together to ensure Kleen-Tech’s services meet Halliburton’s expectations and requirements. Is the Contract still Active?Yes X No KLEEN-TECH 48 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 28 OF 43 638 To Whom it May Concern, Please accept this letter as a recommendation for Kleen-Tech .Kleen-Tech provides janitorial, floor care services and detailed Green Cleaning program for our LEED Certified buildings that span over 2.2 million square feet of office,lab,manufacturing and warehouse space throughout Halliburton’s North Belt Corporate Campus. We are very pleased with the level of service and quality delivered by Kleen-Tech and highly recommend them for services. Sincerely, Joshua Rogers,FMP,LEED Green Associate Sr.Property Manager Real Estate Services,North Belt 3000 N Sam Houston Pkwy E Houston,TX 77032 Email:Joshua.Rogers@Halliburton.com Office:+1 281-871-5020 Mobile:+1 713-689-9473 Fax:+2818714446 Link to Submit a Facility Service: https://sapportal.corp.halliburton.com/webdvnpro/resources/halliburton.com/real est/RealEstate Janitorial Requests:KTMissionControl@K-TServices.com KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 29 OF 43 639 FORM 9 KEY STAFF &PROPOSED SUBCONTRACTORS KEY STAFF Please complete the following chart with the Firm’s proposed Key Staff.If additional space is required,please copy/duplicate this page and attach to this Form.Additional space:a No Yes Name Title Years of Experience Years with Firm Licenses/Certifications Robert Sefton Director of Operations 31 31 Kleen-Tech Director Certified Kleen-Tech Quality Inspector Certified Anthony Maglia Vice President 14 4 Please explain the Firm’s ability and resources to substitute personnel with equal or higher qualifications than the Key Staff they will substitute for where substitute is required due to attrition,turnover,or a specific request by the City: Kleen-Tech has a succession plan in place for all key staff members should the need arise.As referenced by the organizational chart on page 38,if the Supervisor needed to be substituted for any reason,the Director of Operations would step in and provide coverage until the position is filled,and the roles above the Director of Operations would fill in below them.We build layers of supervision and support into our staffing plan and give our management and supervision personnel full authority to execute our scope of work,ensuring our field teams are fully empowered to make tire decisions needed to deliver exceptional service to the City of South Miami on a daily basis. 49 of 92 KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 30 OF 43 640 Docusign Envelope ID:1B3F3C01-0628-4ECF-9B56-F1344635C39B Please identify each Key Staff member’s engagement commitments that will exist concurrently with the City’s Services: Key Staff Name Area of Responsibility Client Commitment (Hours/week) Period of Engagement Robert Sefton State of Florida Multiple Varied Varied Anthony Maglia Florida,Pennsylvania, South Carolina.Connecticut Multiple Varied Varied • PROPOSED SUBCONTRACTORS The undersigned Proposer hereby designates,as follows,all major subcontractors whom they propose to utilize for the major areas of work for the services.The bidder is further notified that all subcontractors shall be properly licensed,bondable,and shall be required to furnish the City with a Certificate of Insurance in accordance with the contract general conditions.Failure to furnish this information shall be grounds for rejection of the bidder’s proposal.(If no subcontractors are proposed,state “None"on first line below.) Subcontractor Name &Address Scope of Work License Number None Firm:Kleen-Tech Semcgg^^ Authorized Signature:Date:1/14/2025°1 32501 lares 1 1 upi Print or Type Name:James Vaughan Title:CEO KLEEN-TECH 50 of 92 City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 31 OF 43 641 Oocusign Envelope ID:D36D15F0-B161-404A-B38E-DA88C6616BA4 ATTACHMENT B DECLARATION/AFFIDAVIT OF REPRESENTATION This affidavit is not required for compliance with the City’s Solicitation;however,it may be used to avoid the need to register members of your presentation team as lobbyists.Pursuant to City Ordinance 28-1 4-2206 (c)(9),any person who appears as a representative for an individual or firm for an oral presentation before a City certification,evaluation, selection,technical review,or similar committee,must list on an affidavit provided by the City staff,all individuals who may make a presentation.The affidavit must be filed by staff with the Clerk's office at the time the committee's proposal is submitted to the City Manager.For the purpose of this subsection only,the listed members of the presentation team,with the exception of any person otherwise required to register as a lobbyist,must not be required to pay any registration fees.No person may appear before any committee on behalf of an anyone unless he or she has been listed as part of the firm's presentation team pursuant to this paragraph or unless he or she is registered with the City Clerk’s office as a lobbyist and has paid all applicable lobbyist registration fees. Pursuant to '92.525(2),Florida Statutes,the undersigned,James Vaughan ,makes the following declaration under penalties of perjury: Listed below are all individuals who may make a presentation on behalf of the entity that the affiant represents in connection with Request for Proposals (RFP)No.FN2024-I7 Please note;No person may appear before any committee on behalf of anyone unless he or she has been listed as part of the firm's presentation team pursuant to this paragraph or unless he or she is registered with the Clerk's office as a lobbyist and has paid all applicable lobbyist registration fees. NAME TITLE Tracy White Director of Proposals and Corporate Communications Anthony Maglia Vice President Robert Sefton Director of Operations For the purpose of this Affidavit of Representation only,the listed members of the presentation team,with the exception of any person otherwise required to register as a lobbyist,will not be required to pay any registration fees. The Affidavit of Representation must be filed with the City Clerk's office at the time the committee's proposal is submitted to the City as part of the procurement process. Under penalties of perjury,I declare that I have read the foregoing declaration and that the facts stated in it are true )ss: ) STATE OF FLORID*f £>lo (Old 0 COUNTY OF and specifically that the persons listed above are the members of the presentaticuitlgag^ftgl^e entity listed below. James Uxuzliavb t^bouBPCgnanSignature me or has produced as identification MONICAA STANARD-CATLETT NOTARY PUBLIC STATE OF COLORADO NOTARY ID 20134021139MYCOMMISSIONEXPIRES04OS2025 "Kotaii Public / Print Name The foregoing instrument was acknowledged before me by means of physical presence or online notarization thisJ?^/-day of ,20^7 by S L&h AH , on behalf of.C ZZT .She/He {£is pe/sonally known to 64 of 92 (KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 32 OF 43 1.7.3.: Proof of Experience Provide documentation evidencing the experience of the Proposer and that the Proposer has successfully provided Services similar to those specified herein to other governmental entities, including municipalities of similar size and needs as the City. The Proposer firm shall be currently engaged in Services on a full-time basis and shall have been in existence and continuous operation providing the Services for a minimum of five (5) years. Proposer’s experience should demonstrate the Proposer’s: 1.7.3.1. Knowledge of the business operations and the legal requirements associated with the Services. Since 1993, Kleen-Tech has been known as one of America’s leading providers of innovative, high-quality janitorial/custodial services. We continue to service customers located throughout the United States with over 1,800 employees providing the Kleen-Tech brand of service to more than 89 million square feet of commercial and government facilities. At Kleen-Tech, we pride ourselves on the longevity of our customer relationships, many of which have been in place for decades. We achieve these long-term partnerships through our commitment to customer service, which is facilitated by open, honest communication and accountability at every level of our organization, and continuous improvement. Kleen-Tech’s many diverse contracts demonstrate our ability to successfully perform varying scopes of work with professionalism, integrity, strong business ethics, a remarkable safety record and, most importantly, total customer satisfaction. As an award-winning custodial services provider, Kleen-Tech specializes in consistency, demonstrated by our ability to fulfill contract specifications with diligence. We take pride in our longstanding customer relationships, and the tools we have built to maintain fluid lines of communication with our customers. Kleen-Tech has fostered a corporate-wide culture of bringing value to our customers’ organizations and operations that create win-win business relationships with customers and our employees. 1.7.3.2. Experience and a strong background of performing similar janitorial services as the primary consultant and demonstrated experience with similar government organizations or agencies of similar size and scope as the City. The Respondent firm shall be currently engaged in the provision of the Services on a full- time basis and shall have been in existence and providing the Services for a minimum of ten (10) years, with a special preference for experience providing the Work in the State of Florida and especially South Florida. At least five (5) years of the Respondent firm’s experience shall be under its current business name. Kleen-Tech has been providing janitorial services as outlined in the City of South Miami’s RFP for over 30 years. In fact, Kleen-Tech specializes in the provision of high-quality janitorial services to 642 KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 33 OF 43 public sector clients in general, and municipal customers. With Kleen-Tech as its trusted janitorial service provider, the City of South Miami can expect first class janitorial services that allow their employees and the citizens of South Miami to work, play, and access vital services in clean, sanitary, and beautiful buildings that they take civic pride in. Kleen-Tech has developed a robust training system to equip our janitors with the skills needed to meet this level of service, and a rigorous Quality Assurance Program to ensure that our team meets the standards of the City of South Miami and Kleen-Tech from the first day of the contract. Kleen-Tech’s Guiding Principles include the belief that “It’s All About the People.” This value can be seen in practice through our dedication to providing the best possible value and service to public sector customers like the City of South Miami. The public services provided by local and county-level officials have a profound and long-lasting impact upon the quality of life in the communities they serve, communities that our employees often call home. With this in mind, we cherish any opportunity to partner with local governments like the City of South Miami to ensure that your facilities are as clean, sanitary, and pleasantly tidy as the day they first opened. For Kleen-Tech, these standards are not just words on the page. Our decades of experience and the systems, processes, and tools that we have developed over that time allow us to ensure that we are able to provide this peace of mind to our customers far more reliably than our competitors. These claims are proven through over three decades of experience providing high quality janitorial and floor care services to cities and counties, federal agencies, and public universities. A selection of such customers, including customers in South Florida, are: Customer Facilities Number of Years Under Contract City of Lake Worth Beach, Florida 118,954 square feet 8 facilities 2021 to present City of Boca Raton, Florida 277,906 square feet 28 facilities 2/2024 to present City of West Palm Beach, Florida 42,624 square feet 21 facilities 2023 to present City of Boulder, Colorado 540,000 square feet 62 facilities Past: 05/13/2013 to 12/31/2021 Current: 01/01/2022 to present Jefferson County, Colorado 947,687 square feet 22 facilities Past: 08/28/2017 to 08/07/2022 Current: 08/08/2022 to present City of Lubbock, Texas 588.703 square feet 49 facilities 2019 to present 643 KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 34 OF 43 City of Marble Falls, Texas 47,000 square feet 8 facilities 2021 to present City of Plymouth, Minnesota 75,800 square feet 6 facilities 2021 to present City of Hercules, California 94,350 square feet 15 facilities 2023 to present 644 KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 35 OF 43 1.7.4.: Previous Projects Respondent should demonstrate proof of completion for at least three (3) previously completed or ongoing janitorial services engagements within the past five (5) years, as identified in the list of recent contracts provided under Form 6. As identified in the list on Form 6, the following current service engagements can be contacted for proof of ongoing services within the last five years: City of Lake Worth Beach, Florida Phil Johnson, Facilities Manager Phone: 561-719-5291 Email: pwjohnson@lakeworthbeachfl.gov City of Boca Raton, Florida Diahanne M. Wong, Facilities Contract Administrator Phone: 561-416-3851 Email: dmwong@myboca.us City of West Palm Beach, Florida James Looney, Utilities Operations and Maintenance Superintendent Phone: 561-246-7240 Email: jlooney@wpb.org City of Plymouth, Minnesota Amy Hanson, Fleet & Facilities Manager Phone: 763-509-5526 Email: aehanson@plymouthmn.gov City of Marble Falls, Texas Tony Kelly Phone: 830-265-7408 Email: tkelly@marblefallstx.gov 645 KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 36 OF 43 1.7.5.: Proposer’s Qualifications Include name, function, and qualifications of the Proposer’s firm and Project Manager. The Project Manager or contact assigned to the Services shall within the past three (3) years have conducted and been responsible for providing Services in a similar project or environment. Please note, to receive further consideration, all Proposers must provide the necessary documentation to demonstrate that they meet the following minimum qualifications: Robert Sefton, Director of Operations and City of South Miami Project Manager With 31 years of custodial experience with Kleen-Tech, Director of Operations Robert Sefton performs periodic visits to ensure Kleen-Tech is 100% compliant with the scope of services and to ensure the City of South Miami is 100% satisfied with the service being received. The Director of Operations provides leadership, direction, and evaluates the overall effectiveness of our services and of the Area Supervisor’s performance. Mr. Sefton’s resume, which details his wealth of knowledge and custodial operations experience, has been provided in the next section. 1.7.5.1. Service and Incorporation. Contractor shall have been in business and continuous operation and service and incorporated in the State of Florida for a minimum of five (5) years. Kleen-Tech has been operating in Florida since 1993. 1.7.5.2. Licenses. Contractor must be fully licensed with any and all applicable and required licenses, certifications and permits for Services, including government licenses, certifications, and permits from the State of Florida, Miami-Dade County, the City, and any other governing governmental regulatory authorities or sports associations. Kleen-Tech is licensed to do business in the State of Florida and Miami-Dade County. Florida Certificate of Status Document Number: M20000008035 Miami-Dade County Business Tax License Number: 7603997 646 KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 37 OF 43 1.7.6.: Personnel Qualifications/Key Staff The Proposer must include the following information for this requirement: 1.7.6.1. Key Staff. Complete and submit Form 9, Key Staff and Proposed Subcontractors. Include a one-page resume with contact information for each Key Staff members. Resumes should include experience with similar services, specifying the role the individual employee served in the provision of the Services. Key Staff Resumes: 647 QKLEEN-TECH Robert Sefton -Director of Operations RSefton@Kleen-Tech.com *Cell:(561)239-5047 *Fax:(954)974-7433 EXPERIENCE SUMMARY More than 30 years of experience in the janitorial/custodial industry.Successfully directs the daily operations of numerous accounts.Ensures customer satisfaction and builds strong customer relationships. Director of Florida Operations,Kleen-Tech 2024-Present •Provides Regional Operations Leadership,overseeing subordinate managers execution of schedules,budgets,labor, supplies,equipment and customer interface/satisfaction •Plans,assigns,and directs work;appraising performance,coaching,developing and mentoring staff •Assures team consistently meets contract requirements •Approves and prices non-contract request •Serves as Kleen-Tech's primary customer interface •Holds Operations Manager (OM)and Area Supervisors accountable in conducting weekly visits with Property Managers,according to our customer calendar •Holds team accountable to meet deadlines according to plan •Leads his team in embracing on-going leadership development and applying leadership in each and every task •Coordinates phase in/out of accounts •Supports Vice President Operations Manager,Kleen-Tech 1994-2024 •Ensured all Operations were within budget requirements •Directed Project Managers and Supervisors in day-to-day janitorial operations for office settings,universities/colleges and industrial facilities •Conducted weekly visits with Property Managers,according to our customer calendar •Coordinated scheduling of all employeesand customer requested projects •Managed the Quality Control Program,including creation of inspection procedures from contract scope of work,best commercial practices and industry performance standards •Calculated inspection frequencies and inspected janitorial services according to established inspection procedures that included:calculation of inspection frequencies,documentation of inspection results,recording and plotting QC metrics,trend analysis,and the directions of re-work and deficiency correction •Maintained the Quality Control Program •Maintained the Training and Safety Program •Monitored equipment and supply inventories •Assisted with start ups of new accounts •Assisted the Director with special projects COMPUTER SKILLS Proficient in Microsoft Outlook,Word and Excel CERTIFICATIONS Kleen-Tech Director Certified Kleen-Tech Quality Inspector Certified (KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 38 OF 43 1.7.6.2. Organizational Chart. Provide an organizational chart showing reporting structure for all Key Staff, including any key subcontractors. The organizational chart on the following page provides a visual representation of Kleen-Tech’s management structure that will support the City of South Miami’s needs for Janitorial Services. 648 Anthony Maglia -Vice President Ckleen-tech866-385-0672 EXPERIENCE SUMMARY Accomplished and detail-oriented professional with broad experience in managing on-site operations,leading top-performing teams,and maintaining top levels of client service.Skilled in optimally utilizing all available resources and implementing improved procedural processes to increase efficiency and quality.Excel at aligning core business,operations,and management goals to enhance customer satisfaction. Vice President,Kleen-Tech Denver,Colorado;2022-Present •Serves as a member of Kleen-Tech's Executive Leadership Team and directs the operations of facility support projects nationally including the eastern U.S.&new territories. •Oversight of leadership teams responsible for close to 1,000 employees,project managers, and supervisors. •Provides developmental input and oversees rollout of operational system upgrades, reporting tools,training &safety programs across all territories. •Leads new contract phase-ins and special projects. Integration Manager,Kleen-Tech Denver,Colorado;2020-2022 •Lead all aspects of integrating newly acquired businesses from initial due diligence of companies to service integration into our systems,processes &tools. •Serve as primary contact point both internally and externally for integrating new companies and operations.Established processes to increase accountability to produce results in a timely fashion. Chief Executive Officer,Homecare Software Solutions,LLC Longmont,Colorado;2017-2020 •Led all aspects of software company start-up from scratch to completion through utilizing prior software systems. Vice President of Options Home Care Operations,HB Management Group Denver,Colorado;2011-2017 •Spearheaded the planning and execution of day-to-day company operations,serving over 1500 clients and employing more than 1400 staff. •Served as a key leader in New Mexico along with all providers and Managed Care Organizations. Education Bachelor of Science in Human Development &Family Studies Colorado State University -Fort Collins,Colorado KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 39 OF 43 649 KLEEN-TECH Custodial Crew Dante Fascell Park Custodial Crew Mobley Building Custodial Crew Com m unity Center Robert Sefton Director of Operations Kleen-Tech South Florida Custodial Crew Senior Citizens Center Custodial Crew Basketball Gynm asium Custodial Crew Sylva Martin and Porch Custodial Crew Public Works &Motor Pool James Vaughan Chief Executive Officer Kleen-Tech Corporate Support Departments Kleen-Tech Proposed Area Lead Area Lead Kleen-Tech for City of South Miam i Anthony Maglia Vice President,Eastern Operations Kleen-Tech East City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 40 OF 43 1.7.7.: Insurance Certificates Proposer shall provide certificates of insurance demonstrating compliance with the requirements set forth under Section 2 of this solicitation, including: 1.7.7.1. Commercial General Liability 1.7.7.2. Workers Compensation & Employer’s Liability 1.7.7.3. Business Automobile Liability Please see the following page for Kleen-Tech’s Certificate of Insurance. Within two business days of receipt of a notice of contract award, Kleen-Tech will provide a copy of the certificate with the City listed as an additional insured. 650 KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 41 OF 43 651 CERTIFICATE OF LIABILITY INSURANCE DATE (MM/DD/YYYY) 1/9/2024 ACORD THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER.THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND,EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW.THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S),AUTHORIZED REPRESENTATIVE OR PRODUCER,AND THE CERTIFICATE HOLDER. IMPORTANT:If the certificate holder is an ADDITIONAL INSURED,the policy(ies)must have ADDITIONAL INSURED provisions or be endorsed. If SUBROGATION IS WAIVED,subject to the terms and conditions of the policy,certain policies may require an endorsement.A statement on this certificate does not confer rights to the certificate holder in lieu of such endorsement(s). PRODUCER IMA,Inc.-Colorado Division 1705 17th Street,Suite 100 Denver CO 80202 CONTACTname:IMA Denver Team S°Nno FBI 303-534-4567 FAX(A/C,No): E-MAIL a *-r .address:DenAccountTechs(5>imacorp com INSURER(S)AFFORDING COVERAGE NAIC# INSURER A:Travelers Casualty and Surety Company of America 31194 INSURED KLEEACQ Kleen-Tech Services,LLC 7100 Broadway,Suite 6L Denver,CO 80221 insurers:*Pinnacol Assurance 41190 insurerc:Zurich American Insurance Company 16535 insurer d:Middlesex Insurance Company insurer e: INSURER F : 23434 COVERAGES CERTIFICATE NUMBER:2015161983 REVISION NUMBER: THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIOD INDICATED.NOTWITHSTANDING ANY REQUIREMENT,TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN,THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS, EXCLUSIONS AND CONDITIONS OF SUCH POLICIES.LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. DESCRIPTION OF OPERATIONS I LOCATIONS /VEHICLES (ACORD 101,Additional Remarks Schedule,may be attached if more space is required) INSR LTR TYPE OF INSURANCE ADDL INSD SUBR WVD POLICY NUMBER POLICY EFF(MM/ED/YYYY)POLICY EXP(MM/DD/YYYY)LIMITS D X COMMERCIAL GENERAL LIABILITY x OCCUR A0237592004 1/1/2024 1/1/2025 EACH OCCURRENCE S 1.000,000 J CLAIMS-MADE DAMAGE TO RENTEDPREMISES(Ea occurrence)S 1.000,000 X XCU Not Excluded MED EXP (Any one person)$5,000 PERSONAL &ADV INJURY $1,000,000 GEN'L AGGREGATE LIMIT APPLIES PER: _LOC GENERAL AGGREGATE $3.000,000 X POLICY |X PRODUCTS -COMP/OP AGG $2,000,000 OTHER:S D AUTOMOBILE LIABILITY X ANY AUTO OWNED AUTOS ONLY Y HIRED y AUTOS ONLY SCHEDULED AUTOS NON-OWNED AUTOS ONLY A0237592001 1/1/2024 1/1/2025 COMBINED SINGLE LIMIT(Ea accident) BODILY INJURY (Per person) BODILY INJURY (Per accident) PROPERTY DAMAGE(Per accident) S 1,000,000 s s s s D X UMBRELLA LIAB EXCESS LIAB DED |X RETENTK X DN S OCCUR CLAIMS-MADE n A0237592005 1/1/2024 1/1/2025 EACH OCCURRENCE AGGREGATE S 5,000,000 S 5,000,000 s BC WORKERS COMPENSATION AND EMPLOYERS'LIABILITY y,NANYPROPRIETOR/PARTNER/EXECUTIVE .OFFICERMEMBER EXCLUDED7 N (Mandatory in NH) If yes.describe under DESCRIPTION OF OPERATIONS below N/A 4220890 WC302962204 1/1/2024 1/1/2024 1/1/2025 1/1/2025 Y PER OTH-A STATUTE ER E.L EACH ACCIDENT $1,000,000 E.L DISEASE-EA EMPLOYEE $1,000,000 E.L DISEASE-POLICY LIMIT $1,000,000 A CRIME 107102503 1/1/2024 1/1/2025 Employee Theft Deductible $1,000,000 $25,000 CERTIFICATE HOLDER CANCELLATION For Information Only I SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF.NOTICE WILL BE DELIVERED IN ACCORDANCE WITH THE POLICY PROVISIONS. AUTHORIZED REPRESENTATIVE ©1988-2015 ACORD CORPORATION.All rights reserved. ACORD 25 (2016/03)The ACORD name and logo are registered marks of ACORD (KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 42 OF 43 1.7.8.: Additional Information Kleen-Tech ensures the highest quality of service of our daily operations through our customized systems, processes and tools (SPTs) with a focus on ensuring every single employee is plugged in to these SPTs. These SPTs add significant value to our service offerings and customers. We believe these features should be standard-issue: in the same way you expect seatbelts in any new car you purchase, your custodial contractor must have processes in place to ensure the full delivery of service in a manner that meets or exceeds your expectations. Our systems, processes, and tools do just that. For Kleen-Tech, these standards are not just words on the page; our decades of experience and these features ensure we provide this peace of mind to our customers far more reliably than our competitors. With Kleen-Tech as your custodial services provider, you receive full access to, as well as the benefit of, our SPTs, which include:  Mission Control: Kleen-Tech’s 24/7 Communications Center provides customers and employees with round-the-clock support. Mission Control Dispatchers are trained to respond to requests and concerns, create work orders, and create Raise The Flag incident reports. The processes carried out by Mission Control document the various occurrences in any given day and are the means by which we hold ourselves accountable to meet our commitments and the needs of our Clients.  SHARP Work Order System: through this system we document and track all work tasks due and complete. Mission Control Dispatchers review open and upcoming Work Orders with Leads and Supervisors on their Daily Calls.  Raise The Flag Incident Reporting System: when a standard is in jeopardy or an issue arises, it is documented and our team acts immediately to resolve issues and ensure we have taken steps to prevent recurrence. Through this system we achieve our commitment to transparency and continuous improvement.  Site Specific Checklists: Kleen-Tech creates site-specific checklists for each facility (and at larger facilities for each zone/area within the facility for the assigned custodial employee) to ensure all services are performed according to the scope of work and schedule.  Quality Assurance Program: we routinely document Quality Assurance inspections and their results. Our Quality Assurance App for smartphones automatically creates Work Orders for any identified deficiencies and Raise The Flag reports for scores below our standard, ensuring the proper follow up and escalation of any issue.  Monthly Customer Survey: each month we ask our customers to score our services for the prior month on a 5 to 1 scale and provide the top improvement we can make to improve our score the following month. This 1-minute survey facilitates ongoing improvement and customer satisfaction. 652 KLEEN-TECH City of South Miami RFP No. FN2024-17, Janitorial Services PAGE 43 OF 43  Weekly Leadership Meetings: our leadership teams meet weekly to discuss a variety of topics. During these meetings, actions are documented and commitment dates are created and documented, allowing our teams to maintain transparency and to hold themselves and each other accountable to their commitments. We know these systems, processes, and tools are most effective when our employees are plugged in and have embraced our company culture. Therefore, we actively work to plug all employees in to our systems, processes, tools, and culture. We do this through a robust and continuous Training Program and a commitment to transparency and communication with—as well as the development of—our employees. At Kleen-Tech, we believe the best predictor of your contractor’s future success is their past performance, and our longstanding customer relationships speak to our ability to exceed expectations in a variety of settings. As a company with more than 2,000 employees nationwide, Kleen-Tech is large enough to supply our clients with the processes, tools, and solutions that even the largest firms envy, but small enough to maintain personal working relationships, ensuring each client’s trust and satisfaction. Kleen-Tech provides the City of South Miami with a local team of experienced leaders and janitorial personnel, supported by a collection of state-of-the- art, customer-centric technology. Our suite of solutions includes an in-house 24/7 Communications Center with multilingual staff, our fully customizable SHARP® work order system—the industry’s very best quality control and event management systems—as well as KRONOS® real-time labor management and Raise The Flag incident reporting systems. In addition to this innovative arsenal of technological solutions, Kleen-Tech takes ownership of all tasks including but not limited to management and supervision, hiring, training, and payroll. As a truly valued client, the City of South Miami always has a direct hotline to Kleen-Tech’s senior leadership and benefits from the latest industry advances that consistently meet your custodial objectives. 653 WHY CHOOSE KLEEN-TECH S With Kleen-Tech at the reins,we take command of all custodial recruitment,training,and supervisory activities J Open,consistent,reliable communicationfacilitatedthroughour24/7/365CommunicationsCenter In-house,multilingual Recruiters and Training Department ensure we haveamplescreened,on-boarded,trained personnel ready to work Our proven successful,cost-effective Supply Management Process ensures continuous savings throughout the duration of the contract Through our supplier relationships,weachieve15-20%volume discounts,which we pass on to you Our robust,highly skilled crew is ready to mobilize to address any customer emergency Streamlined operations and systems, processes,and tools that ensure consistent service delivery J Our Incident Reporting system allows us to track and measure the types ofincidentsthatoccur,which aids us increatingsolutionstopreventissue recurrence Z Exceptional quality achieved through ourQualityAssuranceProgram,proven byourlongstandingcustomerrelationships KLEEN-TECH 654 4SW I $NEIGHBORS I I SUNDAY DECEMBER 29 2024 A Lay’s potato chip recall involves Walmart and other stores. Here’s what to know BY DAVID J.NEAL dneal@miamiherald.com Frito-Lay announced a recall of Lay’s Classic Potato Chips in Party Size bags,but it affects chips sold in only two states. The company’s recall notice says a customer alerted Frito-Lay that milk might be present as an allergen not declared in the packaging.Ingre¬ dients listings declare the allergens present in food products. This covers bags that went to distributors and online sellers in two states,Oregon and Wash¬ ington,and went on sale Nov.3. Among the nation’s leading grocery sellers, No.1 Walmart posted a list of stores that received the recalled bags and No. 2 Kroger stated it involves only its QFC and Fred FOR CUSTOMER SERVICE VISIT US AT: www.miamiherald.com/scrvicc BiiamiHcraD The 'Party Size'bag of Lay's Classic Potato Chips has been recalled in two northwest states because milk might be present asanallergennotdeclared in the packaging. Meyer chains. To identify recalled bags,look for a “Guaran¬ teed Fresh”date of Feb. 11,2025,and manufactur¬ ing codes that start with “6462307”or “6463307.” Call 800-352-4477 weekdays for questions. Police:ManshotintheleginFlorida City,airlifted to hospital A man was found shot in the leg in Florida City early Thursday,according to police. Officers responded around 1 a.m.to the area of 825 W.Lucy St.,where they discovered the injured man,said Sgt.David Huns¬ berger. Police provided emer¬ gency medical aid until Miami-Dade Fire Rescue arrived and airlifted the victim to the Ryder Trauma Center at Jackson South. Police say the man is ex¬ pected to survive. No additional informa¬ tion has been released as the investigation continues. Public Notice PUBLIC MEETING The Miami-Dade County Parks.Recreation and Open Spaces department cordially invite area residents and visitors to attend a public meeting to learn about future enhancements to Joe & Colleen Griffin Park and provide input.Please join us to learn more. JOE &COLLEEN GRIFFIN PARK ENHANCEMENTS Wednesday,January 8,2025 •6:00 p.m. Live Like Bella Park Recreation Center 29305 Illinois Road Miami,FL 33033 For more information on this event or if you are not able to attend the meeting,please contact Carlos Lopez,Park Planner 2,Miami-Dade County Parks,Recreation and Open Spaces Department by phone at 305-755-7987 or by email at Carlos.Looez6@miamidade.qov. To obtain this information in accessible format,please call the Miami-Dade Parks ADA Coordinator at 305-755-7848 or send an email to Gisel.Prado@miamidade.gov. TOWN OF CUTLER BAY NOTICE OF ADOPTION OF RESOLUTION CLOSING AND VACATING PUBLIC STREET The Town of Cutler Bay held a public hearing on Wednesday, December 4,2024,at 6:00 p.m.,and adopted the following resolution vacating and abandoning the public street right-of-way identified below.This notice is provided within 30-days of adoption in accordance with 336.10,Florida Statutes. A RESOLUTION OF THE MAYOR AND TOWN COUNCIL OF THE TOWN OF CUTLER BAY,FLORIDA,APPROVING THE ABANDONMENT AND VACATION OF THE SW 215TH STREET RIGHT-OF-WAY FROM INGRAHAM AVENUE ROAD TO OLD CUTLER ROAD;AND PROVIDING FOR AN EFFECTIVE DATE. Mauricio Melinu,CMC Town Clerk PUBLIC NOTICE REQUEST FOR PROPOSALS (RFP)No.FN2024-17 JANITORIAL SERVICES NOTICE IS HEREBY GIVEN that the City of South Miami (“City”)is soliciting proposals for Janitorial Services (the “Services").Interested companies,firms,and individuals ("Proposers")may obtain a copy of Request for Proposals No.FN 2024-17 (the “RFP")to be issued on December 18,2024 at the City of South Miami 6130 Sunset Drive,South Miami,FL 33143 or on the City’s website at www.southmiamifl.gov,or via DemandStar at https://network.demandstar.com/.The RFP contains detailed information about the scope of Services,submission requirements,and selection procedures.All notices and any addenda issued by the City with respect to the RFP will be made available on the City's website.It is the Proposer’s sole responsibility to ensure receipt of any issued notice or addenda relating to this RFP once posted to the website.The Proposal submission shall be submitted electronically via DemandStar,and marked "Proposal to City of South Miami,RFP No.FN2024-17 for “JANITORAL SERVICES."Proposals must be received by the City by no later than January 23,2025 at 10:00 AM. Proposals will be publicly opened through video conferencing using the Zoom platform.Members of the public are invited to view the Proposal opening meeting through Zoom at https;//zoom,us/i/3056636339 on January 23,at 10:30 AM or by listening to the Proposal opening meeting on a dedicated phone line by dialing +1-786-635-1003 Meeting ID:3056636339. Nkenga A.Payne,CMC,FCRM City ClerkForlegaladsonline,go to legalads.miamidade.gov Document Number FEI/EIN Number Date Filed State Status Last Event Event Date Filed Event Effective Date Department of State / Division of Corporations / Search Records / Search by Entity Name / Detail by Entity Name Florida Limited Liability Company SFM JANITORIAL SERVICES, LLC Filing Information L06000047722 20-4908937 05/09/2006 FL ACTIVE CANCEL ADM DISS/REV 09/27/2007 NONE Principal Address 7500 NW 74TH AVE medley, FL 33166 Changed: 11/16/2022 Mailing Address 7500 NW 74TH AVE medley, FL 33166 Changed: 11/16/2022 Registered Agent Name & Address TRIAY, CARLOS 2301 NW 87 AVE 501 DORAL, FL 33172 Name Changed: 01/15/2009 Address Changed: 01/15/2009 Authorized Person(s) Detail Name & Address Title MGR D C Florida Department of State 3/5/25, 11:55 AM Detail by Entity Name https://search.sunbiz.org/Inquiry/CorporationSearch/SearchResultDetail?inquirytype=EntityName&directionType=Initial&searchNameOrder=SFMJANI…1/2655 Dimm of ,,-—**^>n,^tin official Satie of Florida weibsi/e INFANTE, CHRISTIAN H 7500 NW 74TH AVENUE MEDLEY, FL 33166 Title MGRM SFM SERVICES, INC 7500 NW 74TH AVENUE MEDLEY, FL 33166 Annual Reports Report Year Filed Date 2022 04/25/2022 2023 03/16/2023 2024 03/20/2024 Document Images 03/20/2024 -- ANNUAL REPORT View image in PDF format 03/16/2023 -- ANNUAL REPORT View image in PDF format 04/25/2022 -- ANNUAL REPORT View image in PDF format 04/06/2021 -- ANNUAL REPORT View image in PDF format 04/28/2020 -- ANNUAL REPORT View image in PDF format 04/08/2019 -- ANNUAL REPORT View image in PDF format 04/10/2018 -- ANNUAL REPORT View image in PDF format 03/21/2017 -- ANNUAL REPORT View image in PDF format 03/21/2016 -- ANNUAL REPORT View image in PDF format 02/02/2015 -- ANNUAL REPORT View image in PDF format 02/17/2014 -- ANNUAL REPORT View image in PDF format 02/21/2013 -- ANNUAL REPORT View image in PDF format 01/26/2012 -- ANNUAL REPORT View image in PDF format 01/31/2011 -- ANNUAL REPORT View image in PDF format 04/21/2010 -- ANNUAL REPORT View image in PDF format 03/17/2009 -- ANNUAL REPORT View image in PDF format 01/15/2009 -- ANNUAL REPORT View image in PDF format 01/29/2008 -- ANNUAL REPORT View image in PDF format 09/27/2007 -- REINSTATEMENT View image in PDF format 05/09/2006 -- Florida Limited Liability View image in PDF format Florida Department of State, Division of Corporations 3/5/25, 11:55 AM Detail by Entity Name https://search.sunbiz.org/Inquiry/CorporationSearch/SearchResultDetail?inquirytype=EntityName&directionType=Initial&searchNameOrder=SFMJANI…2/2656 7500 NW 74TH AVE MEDLEY, FL 33166 Current Principal Place of Business: Current Mailing Address: 7500 NW 74TH AVE MEDLEY, FL 33166 US Entity Name: SFM JANITORIAL SERVICES, LLC DOCUMENT# L06000047722 FEI Number: 20-4908937 Certificate of Status Desired: Name and Address of Current Registered Agent: TRIAY, CARLOS 2301 NW 87 AVE 501 DORAL, FL 33172 US The above named entity submits this statement for the purpose of changing its registered office or registered agent, or both, in the State of Florida. SIGNATURE: Electronic Signature of Registered Agent Date Authorized Person(s) Detail : I hereby certify that the information indicated on this report or supplemental report is true and accurate and that my electronic signature shall have the same legal effect as if made under oath; that I am a managing member or manager of the limited liability company or the receiver or trustee empowered to execute this report as required by Chapter 605, Florida Statutes; and that my name appears above, or on an attachment with all other like empowered. SIGNATURE: Electronic Signature of Signing Authorized Person(s) Detail Date FILED Mar 20, 2024 Secretary of State 6061389128CC CHRISTIAN INFANTE MANAGER 03/20/2024 2024 FLORIDA LIMITED LIABILITY COMPANY ANNUAL REPORT No Title MGR Name INFANTE, CHRISTIAN H Address 7500 NW 74TH AVENUE City-State-Zip:MEDLEY FL 33166 Title MGRM Name SFM SERVICES, INC Address 7500 NW 74TH AVENUE City-State-Zip:MEDLEY FL 33166 657 FRIDAYMARCH72025MIAMIHERALD.............................................................................................5ACITYOFSOUTHMIAMI,FLORIDACITYCOMMISSIONMEETINGNOTICEOFPUBLICHEARINGNoticeisherebygiventhattheCityCommissionwillholdapublichearingonTuesday,March18,2025,at7:00p.m.atSouthMiamiCityHallCommissionChambers,6130SunsetDrive,SouthMiami,FL33143,toconsiderthefollowingpublichearingitem(s):ARESOLUTIONOFTHEMAYORANDCITYCOMMISSIONOFTHECITYOFSOUTHMIAMI,FLORIDA,APPROVINGTHEOPERATIONANDMANAGEMENTSERVICESFORYOUTHANDADULTSWIMLESSONANDAQUATICFITNESSPROGRAMSFROMISWIMACADEMYL.L.CFORAFIVE-YEARTERM;AUTHORIZINGTHECITYMANAGERTONEGOTIATEANDTOENTERINTOANAGREEMENTFORYOUTHANDADULTSWIMLESSONANDAQUATICFITNESSPROGRAMMANAGEMENTSERVICESATMURRAYPARKAQUATICCENTER;PROVIDINGFORIMPLEMENTATION,CORRECTIONS,ANDEFFECTIVEDATE.ARESOLUTIONOFTHEMAYORANDCITYCOMMISSIONOFTHECITYOFSOUTHMIAMI,FLORIDA,APPROVINGSFMJANITORIALSERVICES,LLCFORJANITORIALSERVICESFORAFIVE-YEARTERM;AUTHORIZINGTHECITYMANAGERTONEGOTIATEANDTOENTERINTOANAGREEMENTFORJANITORIALSERVICESFORTHECITY;PROVIDINGFORIMPLEMENTATION,CORRECTIONS,ANDEFFECTIVEDATE.ARESOLUTIONOFTHEMAYORANDCITYCOMMISSIONOFTHECITYOFSOUTHMIAMI,FLORIDA,APPROVINGAMULTI-YEARMEMORANDUMOFUNDERSTANDINGWITHTHEUNDERLINEMANAGEMENTORGANIZATION,INC.D/B/ATHEUNDERLINECONSERVANCYRELATEDTOINVESTMENTINTHEUNDERLINEOPERATIONS,PROGRAMMING,MAINTENANCEANDMANAGEMENT;PROVIDINGFORAUTHORIZATION,IMPLEMENTATION,CORRECTIONS,SEVERABILITYANDANEFFECTIVEDATE.ANORDINANCEOFTHEMAYORANDCITYCOMMISSIONOFTHECITYOFSOUTHMIAMI,FLORIDA,AMENDINGTHEFUTURELANDUSEMAPOFTHEFUTURELANDUSEELEMENTOFTHECITYOFSOUTHMIAMICOMPREHENSIVEPLANPURSUANTTOSMALL-SCALEAMENDMENTPROCEDURESSETFORTHINSECTION163.3187,FLORIDASTATUTES,TOCHANGETHEFUTURELANDUSEDESIGNATIONOFCERTAINPARCELSONTHEWESTSIDEOF62NDAVENUEBETWEENSW64THSTREETTOTHENORTHANDSW68THSTREETTOTHESOUTHFROMTHEIRCURRENTDESIGNATIONOF“RESIDENTIAL/LIMITEDCOMMERCIAL”(“RLC”)TO“MIXEDUSECOMMERCIAL/RESIDENTIAL”(“MUCR”);PROVIDINGFORTRANSMITTAL,CORRECTIONS,SEVERABILITY,CONFLICTS,IMPLEMENTATIONANDANEFFECTIVEDATE.ANORDINANCEOFTHEMAYORANDCITYCOMMISSIONOFTHECITYOFSOUTHMIAMI,FLORIDA,AMENDINGTHEFUTURELANDUSEMAPOFTHEFUTURELANDUSEELEMENTOFTHECITYOFSOUTHMIAMICOMPREHENSIVEPLANPURSUANTTOSMALL-SCALEAMENDMENTPROCEDURESSETFORTHINSECTION163.3187,FLORIDASTATUTES,TOCHANGETHEFUTURELANDUSEDESIGNATIONOFCERTAINPARCELSLOCATEDONTHENORTHSIDEOF64THSTREETGENERALLYBETWEENSW59THAVENUEONTHEEASTANDSW59THPLACEONTHEWESTFROMTHEIRCURRENTDESIGNATIONOF“MIXEDRESIDENTIAL-MODERATEDENSITY”(“MRMD”)TO“TOWNHOUSERESIDENTIAL”(“TR”);PROVIDINGFORTRANSMITTAL,CORRECTIONS,SEVERABILITY,CONFLICTS,IMPLEMENTATIONANDANEFFECTIVEDATE.CommissionmemberswillparticipateinChambersorbyvideoconferencingthroughtheZoomplatformandmembersofthepublicmayjointhemeetingviaZoomat(https://zoom.us/j/3056636338),byphonebycalling+1-786-635-1003andenteringMeetingID:3056636338whenprompted,orinpersonintheCommissionChambers,andwheretheirappearancewillbebroadcastontheZoomplatform,andwheretheycanparticipate.Allinterestedpartiesareinvitedtoattendandwillbeheard.Forfurtherinformation,pleasecontacttheCityClerk’sOfficeat:305-663-6340.PursuanttoSection286.0105,Fla.Stat.,theCityherebyadvisesthepublicthatifapersondecidestoappealanydecisionmadebytheCommissionwithrespecttothismatter,suchpersonmustensurethataverbatimrecordoftheproceedingsismade,whichrecordincludesthetestimonyandevidenceuponwhichtheappealistobebased.ThisnoticedoesnotconstituteconsentbytheCityfortheintroductionoradmissionofotherwiseinadmissibleorirrelevantevidence,nordoesitauthorizechallengesorappealsnototherwiseallowedbylaw.ADA:Torequestamodificationtoapolicy,practiceorprocedureortorequestanauxiliaryaideorserviceinordertoparticipateinaCityprogram,activityorevent,youmustonorbefore4:00p.m.3businessdaysbeforethemeeting(notcountingthedayofthemeeting)deliveryourrequesttotheCityClerkbytelephone:305-663-6340,bymailat6130SunsetDrive,SouthMiami,Floridaoremailatnpayne@southmiamifl.gov.NkengaA.Payne,CMC,FCRMCityClerkaboutgettingawayfromallofthedistractions,”shesaid.“It’sabouthelpingoneanother.”Atonetable,twohigh-schoolstudentsfromCar-rolltonSchooloftheSacredHeart,aprestigiousall-girlsCatholicschoolinCoconutGrove,atehalalchicken,Mediterraneanriceandsaladwhilechat-tingabouttheirreligiousviews.CarolinaRhodes,17,pointedoutsomecom-monalitiesbetweenCatho-licismandIslam.“Ineverrealizedhowmanysimilaritiesthereare.Wehaveaseasonoffast-ing,too,lent,thatjuststartedtoday,”Rhodessaid,stillbearingtheblackashonherforeheadfromAshWednesdayMassearlierthatday.“It’saseasonofrepent-ancetocelebratethe40daysJesusspentinthedesert,”shesaid.AndreaLara,17,de-scribedherselfas“cultur-allyCatholic”butnotspiri-tual.Still,shesaidsheenjoyslearningaboutotherreligionsandhowtheyinfluencepeople.Shelearnedthatnight,forexample,thatRamadanalsohasacomponentofcharitablegiving.“Itcanjustmakeyousomuchmoreunderstandingofpeople.Ithelpsyouunderstandyourselfbet-ter,”Larasaid.“Recog-nizingsimilaritiesbetweenpeoplehelpsyoufeelcon-nected,andIfeellikethatpreventsconflicts.”Thehigh-schoolersdidn’tattendontheirown.Theywereaccompaniedbytheirreligionteacher,Pao-laBernardini,whoencour-ages—andrequirestosomeextent—herstu-dentstoexperienceareli-gioustraditionoutsideoftheirown.Shesaidthecommunaliftardinnerisoneofmanywaystobringwhatthestudentsarelearninginclasstolife.“Ithinkthatthepersonalencounterhelpstounder-stand‘theother’betterthansimplylearningaboutitfrombooks,”saidBernar-dini.“Otherfaithtraditionsmayseemveryforeignandstrangebutwhenyoustartmeetingpeople,thesharedhumanityandsimilaritiescometotheforefront.”ThisstorywasproducedwithfinancialsupportfromTrishandDanBellanddonorsinSouthFlorida’sJewishandMuslimcommu-nitiesinpartnershipwithJournalismFundingPart-ners.TheMiamiHeraldmaintainsfulleditorialcontrolofthiswork.LaurenCostantino:@misscostantinoPEDROPORTALpportal@miamiherald.comImanAbdulHamidSamra,left,leadsaprayerduringFIU’siftareventonWednesday.FROMPAGE3AIFTARBenzodiazepinesaredepressantsthatslowdownthecentralnervoussystemandmaycausesleepinessandarelaxedmood,butifoverdosedcancauseextremedrow-siness,confusion,im-pairedcoordination,de-creasedreflexes,respira-torydepression,comaandpossibledeath,accordingtotheDrugEnforcementAdministration.“Thevictimsrecountedbuyingacoupleofbeers,listeningtomusic,anddancingbythemselves,”accordingtoanFBIaffida-vit.Oneofthevictims“rememberedseeingtwowomentaking‘selfies,’andthatheofferedtotakephotosforthem.Here-calledaskingifhecouldplacehisbeerontheirtabletotakethephotos.Neithervictimcouldre-memberwhathappenedafterthatencounter.”Around2:30a.m.onMarch6,thesoldiersandtheduoleftColombianPubtogether.Thedruggedsoldiersstumbledandhaddifficultykeepingtheirbalance,accordingtotheproffer.Uribeputherarmaroundthewaistofoneofthesoldiers,andhehadhisarmonhershoulder.ArangoandUribesteeredtheirvictimstoSilva’sawaitingRenault9,andtheydroveoffwiththesoldiersinsidethecar.USEDSOLDIERS’ATMCARDSThere,accordingtoprosecutors,thetriotookthesoldiers’wallets,debitandcreditcards,andcell-phones.Uribe“furthermanipulated”oneofthesoldierstorevealhisdebitcard’sPINcode.Forthenextfewhours,thetriodrovetheintox-icatedsoldiersaroundBogotáandusedthesto-lencreditandATMcardsatmanylocationswheretheyextractedcash—$350fromtwotrans-actionsandanothertotal$250fromtwoothertransactionsofabout$125apiece.Thecreditcardwasusedlaterthatmorn-ingatameatstoreandatirestore.Around6:45a.m.,thetriodroppedoneofthevictimsoffonthestreetmarkedCalle25.VideofootageshowsthesoldierstumblingandfallingdownonthestreetandUribeliftinghimoffthestreetandguidinghimtoasidewalkwherehewasleft.Apasserbysawthevictimstaggeringandcalledthepolice,thentookthesoldiertoahospi-talwherehewastreatedandreleased.Heeventu-allymadehiswaybacktohisapartmentwherehewasmetbyU.S.Embassypersonnel,accordingtotheproffer.Thesecondsoldierwasalsodroppedoffinthesameneighborhoodandwasfoundbyataxidriverwhohelpedhimgettohisapartment,wherevideofootageshowedhimstum-blingonthewaytohisapartment.JayWeaver:305-376-3446,@jayhweaverFROMPAGE3APLEASclocksaheadanhourbeforegoingtosleeponSaturdaynight.WHATDOESTHETIMECHANGEDOTOMORNINGANDEVENING?Sunriseandsunsetwhenwechangetheclocks:AWhenwemovetheclocksforwardat2a.m.Sunday,sunriseinMiamiwillbeat7:36a.m.andsunsetwillbeat7:27p.m.MonthlysunriseandsunsettimesuntilNo-vember:AApril9:7:03a.m.sunrise,7:41p.m.sunsetAMay9:6:38a.m.sunrise,7:56p.m.sunsetAJune9:6:29a.m.sunrise,8:12p.m.sunsetAJuly9:6:36a.m.sun-rise,8:16p.m.sunsetAAug.9:6:51a.msun-rise.,8:01p.m.sunsetASept.9:7:04a.m.sunrise,7:31p.m.sunsetAOct.9:7:17a.m.sun-rise,6:59p.m.sunsetANov.2:6:30a.m.sunrise,5:38p.m.sunsetWHYDOWETINKERWITHTHECLOCK?ASavingenergy:Day-lightsavingtimeisaboutadesiretosaveenergybyextendingsunlightlaterinthedayduringspringandsummer.Astudyconduct-edbytheU.S.DepartmentofEnergyfoundthatthefour-weekextensionofdaylightsavingtimein2008savedabout0.5%ofthenation’selectricityperday,or1.3trillionwatt-hours—whichisenoughtopower100,000house-holdsforanentireyear.ASafety:Studieshavealsoshownthattheextrahourofdaylighthasre-sultedinsaferroads,low-ercrimeratesandeco-nomicbenefits.ADisruptions:Otherconcernsaboutdaylightsavingtimehaveincludeddisruptionstoharvestingschedulesforfarmers,interferencewithreligiousobservancesbasedonsolarandlunartime,andpotentialdelaysinrework-ingcomputersystemsprogrammedtoswitchtwiceayear.FROMPAGE3ATIMEMARSHAHALPERMiamiHerald|2006ThekineticclockattheFortLauderdaleMuseumofDiscovery&Science.658 P r e p a r e d b y M a r s d e n S e r v i c e s S h a z a r d A l i O ffi c e : 305-340-7524 C e l l : 305-340-7524 E m a i l : S A l i @ m a r s d e n . c o m m a r s d e n . c o m City of South Miami P r o p o s a l f o r J a n i t o r i a l S e r v i c e s R F P N o . F N 2 0 2 4 -17 1 373659 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .7 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .9 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .18 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .22 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .24 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .28 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .30 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .31 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .32 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .33 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .34 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .36 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37 Table of Contents Cover Page Letter of Interest and Executive Summary Proposal Form 1 Proposal Form 2A Proposal Forms 3 and 4 Proposal Forms 5 and 6 Form 7 Form 8- References Form 9 Bio Ayza Mendoza Bio Richard Wilson Bio -Shazard Ali Org Chart for South Miami About Us Charitable Donations Communication 374660 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .38 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .40 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .42 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .43 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .45 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .50 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .55 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .56 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .57 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64 Hiring Practices Training Uniforms Safety Quality Control Transition Emergency Services Integrated Services Certificate of Insurance 2025 Addendum No. 1 Attachment to Addendum No. 1 375661 © 2021 Marsden Services www.marsden.com Shazard Ali Director of Business Development 305-340-7524 SAli@marsden.com January 22, 2025 City of South Miami Attn: Steven P. Kulick 6130 Sunset Drive City of South Miami, Florida 33143 RE: Proposal Package-Letter of Interest Dear Steven, Thank you for the opportunity to submit a bid package in response to the RFP for Janitorial Services for City of South Miami. Marsden Services understands how important it is for City of South Miami (South Miami)to have a janitorial partner who can provide efficient and consistent facility services. I am confident that Marsden can provide you with the skilled teams, comprehensive quality programs, and customer-focused services that are necessary to maintain the cleanliness, appearance, and safety of your property. Our day cleaning program aligns well with the service hours of your locations, and we can certainly provide after hours services to City Hall. Enclosed you will find our proposal. If you would like additional information or have questions, please reach out to me. We look forward to your evaluation of our proposal and the opportunity to discuss a partnership between Marsden Services and South Miami. Sincerely, Shazard Ali Director of Business Development 4 376662 © 2021 Marsden Services www.marsden.com Executive Summary City of South Miami (South Miami)'s facility is an important component in your everyday business operations. Marsden understands that a building's cleanliness, appearance, and safety has a direct impact on your business and your associates. South Miami needs an experienced service partner who can care for your building and help you to maintain a positive, productive atmosphere. Marsden has been serving clients for over 70 years, providing small and large business including government facilities with well-maintained and welcoming facilities. We get to know each of our clients individually and provide services that are tailored to their needs and their facility's unique environment. Our cleaning teams are carefully vetted and thoroughly trained, and our cleaners receive local support and appropriate site supervision. Our frequent cleaning inspections assure quality expectations are met and our efficient operating spend is kept within strict cost controls. Key Program Components Below are a few program highlights, which are described in detail later in this document. We look forward to meeting with you to discuss our entire program in more depth. Component Benefit Description Full, Qualified Work Resources Peace of Mind from Fully Vetted Staff •Carefully selected staff members o Rigorous new-hire screening measures o HR staff review experience, background, and records •Staff follow security protocols of City of South Miami •Consistent, stable teams with low turnover Site-based, Cleaning Approach High Confidence in Service Performance •City of South Miami-driven service schedules •Work performed during off-hours •Periodic tasks (non-daily): o Scheduled, performed and tracked o Results and schedules sent to City of South Miami •Flexible and trained staff respond to changing needs Rigorous Quality Control Full Contract Compliance •Experience cleaning to ISSA Custodial Standards •Unique Key Performance Indicators (KPIs) for client site •Cleaning inspections and audits via cloud-based, mobile QC system •Detailed performance reporting and quality metrics •Supervisors review daily and periodic work •Labor management ensures full staffing 5 377663 © 2021 Marsden Services www.marsden.com Thank you for your interest in a partnership with Marsden Services. Our goal is to provide exceptional services, but more importantly, to develop a successful relationship with the City of South Miami. Component Benefit Description Advanced Technology and Innovation 100% Performance Transparency and Optimal Efficiency •Cloud-based QC system via mobile devices o Web platform tracks and reports metrics o City of South Miami receives immediate electronic responses •Cleaning industry-specific ERP system o Technology-assisted labor management o Fully integrated financial, operations and workforce management o Streamlines processes and delivers complete picture •Continuous R&D: innovative products, tools, processes Strict Cost Controls Maintaining Budget Goals •Complete transparency with the resources used, activities performed and associated costs •Drive toward budget goals while maintaining service levels •Constantly considering ways to implement value engineering o We work with City of South Miami to find ways to increase efficiencies, improve functionality, or reduce costs o Flexible service offerings to meet client needs •Mindful of cost containment 6 378664MMARSDEN FORM 1 PROPOSAL FORM PACKAGE ACKNOWLEDGEMENTS I hereby propose to furnish the goods and services specified in the Request for Proposals,RFP No. FN2024-17.I agree that my Proposal will remain firm for a period of 180 days after opened by the City in order to allow the City adequate time to evaluate the Proposal. I certify that all information contained in this Proposal is truthful to the best of my knowledge and belief. I further certify that I am duly authorized to submit this Proposal on behalf of the Firm named as the Proposing Firm and that said Firm is ready, willing, and able to perform if awarded the Agreement. I further certify, under oath, that this Proposal is made without prior understanding, agreement, connection, discussion, or collusion with any other person, firm or corporation submitting a Proposal; no officer, employee or agent of the City of South Miami or any other Proposer has an interest in said Proposal. Furthermore, I certify that the undersigned executed this Proposal Form with full knowledge and understanding of matters therein contained and was duly authorized. I further certify that the Proposer acknowledges receipt of all Addenda issued by the City in connection with the RFP (Check the box next to each addendum received). ______ Addendum 1 Addendum 6 ______ Addendum 2 Addendum 7 ______ Addendum 3 Addendum 8 ______ Addendum 4 Addendum 9 _______ Addendum 5 Addendum 10 Attached hereto are the following forms/documents which form a part of this Proposal: Form 1. Proposal Form Package Acknowledgement. Form 2A. Proposer (if Company or Corporation) Form 2B. Proposer Partnership) Form 3. Single Execution Affidavits Form 4. Dispute Disclosure Form 5. Certification Regarding Debarment, Suspension, & Other Responsibility Matters Primary Covered Transactions Form 6. Proposer Survey Form 7. Price Proposal Form Form 8. Reference List Form 9. Key Staff & Proposed Subcontractors 27 of 92 X 7 379665 ’s Certification ’s Certification (if ’s Qualifications FORM 1 PROPOSAL FORM PACKAGE ACKNOWLEDGEMENTS (CONTINUED) ___________________________________________ NAME OF PROPOSER FIRM ____________________________________________ SIGNATURE OF PROPOSER ____________________________________________ NAME & TITLE, TYPED OR PRINTED MAILING ADDRESS ____________________________________________ ____________________________________________ (____) ______________________________________ TELEPHONE NUMBER State of Florida County of The foregoing instrument was acknowledged before me by means of physical presence or online notarization, this day of , 20 , by (name of person) as (type of authority) for (name of party on behalf of whom instrument is executed). Notary Public (Print, Stamp, or Type as Commissioned) Personally known to me; or Produced identification (Type of Identification: ) Did take an oath; or Did not take an oath 28 of 92 8 380666 Marsden South,LLC Shazard Ali,Director of Business Development x DocuSigned by: SlwywtL (Ka 405C1E0229AE44A... 1388 SW 8th Street Pompano Beach,FL 33069 305-340-7524 Ohio Franklin 20th Marsden South,LLC January 25 Director of Business Development X Shazard Ali 13A217011A6B46A... JACQUfUHE S MOORE Notary Public State of Ohio My Comm.Expire! January 3,2028 9 381667 FORM 2A PROPOSER’S CERTIFICATION (if Company or Corporation) CERTIFICATE STATE OF MINNESOTA ) )SS COUNTY OF HENNEPIN ) I HEREBY CERTIFY that the Board of Directors of Marsden South,LLC state of Delaware make the resolution date January 17,2025: RESOLVED,that,as President of the Corporation/Company,Mark Dorenkott be and is hereby authorized to execute the Proposal dated,January 20,2024 to the City of South Miami for RFP No.FN2024-17 “Janitorial Services,”and that this execution thereof,attested by the Secretary of the Corporation/Company,and shall be the official act and deed of this Corporation/Company. I further certify that said resolution is now in full force and effect. IN WITNESS WHEREOF,I have hereunto set my hand and affixed the official seal of corporation/company on this the 20th of January,2025. (SEAL) Damon I -asor (Jan 20,2025 11:52 C SI) Damon Fraser Chief Administrative Officer &Secretary Marsden Services,LLC 29 of 92 10 382668 FORM 3 SINGLE EXECUTION AFFIDAVITS This form must be signed and sworn to in the presence of a notary public OR OTHER OFFICIAL AUTHORIZED TO ADMINISTER OATHS. THIS FORM COMBINES SEVERAL AFFIDAVIT STATEMENTS TO BE SWORN TO BY THE PROPOSER OR PROPOSER AND NOTARIZED BELOW.IN THE EVENT THE PROPOSER OR PROPOSER CANNOT SWEAR TO ANY OF THESE AFFIDAVIT STATEMENTS,THE PROPOSER OR PROPOSER IS DEEMED TO BE NON¬ RESPONSIBLE AND IS NOT ELIGIBLE TO SUBMIT A PROPOSAL/PROPOSAL. THESE SINGLE EXECUTION AFFIDAVITS ARE SUBMITTED TO THE CITY OF SOUTH MIAMI AND ARE STATEMENTS MADE: By:Daniel Niswonger For (Name of Proposing or Bidding Entity):Marsden South,LLC Whose business address is:12501 Reed Road,Sugar Land,TX 77478 And (if applicable)its Federal Employer Identification Number (FEIN)is:46-4325823 (if the entity does not have an FEIN,include the Social Security Number of the individual signing this sworn statement.SS#:) Americans with Disabilities Act Compliance Affidavit The above named firm,corporation or organization is in compliance with and agrees to continue to comply with,and assure that any subcontractor,or third party contractor under this project complies with all applicable requirements of the laws listed below including,but not limited to, those provisions pertaining to employment,provision of programs and services,transportation, communications,access to facilities,renovations,and new construction. •The American with Disabilities Act of 1990 (ADA),Pub.L.101-336,104 Stat 327,42 USC 1210112213 and 47 USC Sections 225 and 661 including Title I,Employment;Title II,Public Services;Title III,Public Accommodations and Services Operated by Private entities;Title IV,Telecommunications;and Title V,Miscellaneous Provisions. •The Florida Americans with Disabilities Accessibility Implementation Act of 1993, Section 553.501-553.513,Florida Statutes: •The Rehabilitation Act of 1973,229 USC Section 794; •The Federal Transit Act,as amended 49 USC Section 1612; •The Fair Housing Act as amended 42 USC Section 3601-3631. Proposer Initials 31 of92 11 383669 Public Entity Crimes Affidavit I understand that a “public entity crime”as defined in Paragraph 287.133(1)(g),Florida Statutes, means a violation of any state or federal law by a person with respect to and directly related to the transaction of business with any public entity or with an agency or political subdivision of any other state or of the United States,including but not limited to,any Proposal or contract for goods or services to be provided to any public entity or an agency or political subdivision of any other state or of the United States and involving antitrust,fraud,theft,bribery,collusion,racketeering, conspiracy,or material misrepresentations. I understand that “convicted”or “conviction”as defined in Paragraph 287.1 33(l)(b),Florida Statutes,means a finding of guilt or a conviction of a public entity crime,with or without an adjudication of guilt,in any federal or state trial court of record relating to charges brought by indictment or information after July 1,1989,as a result of a jury verdict,non-jury trial,or entry of a plea of guilty or nolo contendere. I understand that an “affiliate”as defined in Paragraph 287.1 33(l)(a),Florida Statutes,means: 1.A predecessor or successor of a person convicted of a public entity crime;or 2.An entity under the control of any natural person who is active in the management of the entity and who has been convicted of a public entity crime.The term “affiliate”includes those officers, directors,executives,partners,shareholders,employees,members,and agents who are active in the management of an affiliate.The ownership by one person of shares constituting a controlling interest in another person,or a pooling of equipment or income among persons when not for fair market value under an arm’s length agreement,shall be a prima facie case that one person controls another person.A person who knowingly enters into a joint venture with a person who has been convicted of a public entity crime in Florida during the preceding 36 months shall be considered an affiliate. I understand that a “person”as defined in Paragraph 287.133(l)(e),Florida Statutes,means any natural person or entity organized under the laws of any state or of the United States with the legal power to enter into a binding contract and which proposals or applies to Proposal on contracts for the provision of goods or services let by a public entity,or which otherwise transacts or applies to transact business with a public entity.The term “person”includes those officers,directors, executives,and partners,shareholders,employees,members,and agents who are active in management of an entity. Based on information and belief,the statement,which I have marked below,is true in relations to the entity submitting this sworn statement. (INDICATE WHICH STATEMENT APPLIES.) IX Neither the entity submitting this sworn statement,nor any of its officers,directors, executives,partners,shareholders,employees,members,or agents who are active in the management of the entity,nor any affiliate of the entity has been charged with ad convicted of a public entity crime subsequent to July 1,1989. The entity submitting this sworn statement,or one or more of its officers,directors, executives,partners,shareholders,employees,members,or agents who are active in the 32 of 92 12 384670 management of the entity,or an affiliate of the entity has been charged with and convicted of a public entity crime subsequent to July 1,1989. The entity submitting this sworn statement,or one or more of its officers,directors, executives,partners,shareholders,employees,members,or agents who are active in the management of the entity,or an affiliate of the entity has been charged with and convicted of a public entity crime subsequent to July 1,1989.However,there has been a subsequent proceeding before a Hearing Officer of the State of Florida ,Division of Administrative Hearings and the final Order entered by the Hearing Officer determined that it was not in the public interest to place the entity submitting this sworn statement on the convicted vendor list (attach a copy of the final order). I understand that the submission of this form to the contracting officer for the public entity identified in paragraph 1 above is for that public entity only and that this form is valid through December 31 of the calendar year in which it is filed.I also understand that I am required to inform the public entity prior to entering into a contract in excess of the threshold amount provided in Section 287.017,Florida Statutes for category two of any change in the information contained in this forVi. Proposer Initials No Conflict of Interest or Contingent Fee Affidavit Proposer warrants that neither it nor any principal,employee,agent,representative nor family member has paid or will pay any fee or consideration that is contingent on the award or execution of a contract arising out of this solicitation.Proposer also warrants that neither it nor any principal, employee,agent,representative nor family member has procured or attempted to procure this contract in violation of any of the provisions of the Miami-Dade County and City of South Miami conflict of interest or code of ethics ordinances.Further,Proposer acknowledges that any violation of these warrants will result in the termination of the contract and forfeiture of funds paid or to be paid to the Proposer should the Proposer be selected for the performance of this contract. Proposer Initials Business Entity Affidavit Proposer hereby recognizes and certifies that no elected official,board member,or employee of the City of South Miami (the "City”)shall have a financial interest directly or indirectly in this transaction or any compensation to be paid under or through this transaction,and further,that no City employee,nor any elected or appointed officer (including City board members)of the City, nor any spouse,parent or child of such employee or elected or appointed officer of the City,may be a partner,officer,director or proprietor of Proposer or Vendor,and further,that no such City employee or elected or appointed officer,or the spouse,parent or child of any of them,alone or in combination,may have a material interest in the Vendor or Proposer.Material interest means direct or indirect ownership of more than 5%of the total assets or capital stock of the Proposer.Any exception to these above described restrictions must be expressly provided by applicable law or ordinance and be confirmed in writing by City.Further,Proposer recognizes that with respect to this transaction or Proposal,if any Proposer violates or is a party to a violation of the ethics 33 of 92 13 385671 Proposer Initials Anti-Collusion Affidavit Proposer Initials Scrutinized Company Certification 1.Proposer certifies that it and its subcontractors are not on the Scrutinized Companies that Boycott Israel List.Pursuant to Section 287.135,F.S.,the City may immediately terminate the Agreement that may result from this RFP at its sole option if the Proposer or its subcontractors are found to have submitted a false certification;or if the Proposer,or its subcontractors are placed on the Scrutinized Companies that Boycott Israel List or is engaged in the boycott of Israel during the term of the Agreement. 2.If the Agreement that may result from this RFP is for more than one million dollars,the Proposer certifies that it and its subcontractors are also not on the Scrutinized Companies with Activities in Sudan,Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List,or engaged with business operations in Cuba or Syria as identified in Section 287.135,F.S.pursuant to Section 287.135,F.S.,the City may immediately terminate the Agreement that may result from this RFP at its sole option if the Proposer,its affiliates,or its subcontractors are found to have submitted a false certification;or if the Proposer,its affiliates, or its subcontractors are placed on the Scrutinized Companies with Activities in Sudan List,or 1.Proposer/Proposer has personal knowledge of the matters set forth in its Proposal/Proposal and is fully informed respecting the preparation and contents of the attached Proposal/Proposal and all pertinent circumstances respecting the Proposal/Proposal; 2.The Proposal/Proposal is genuine and is not a collusive or sham Proposal/Proposal;and 3.Neither the Proposer/Proposer nor any of its officers,partners,owners,agents,representatives, employees,or parties in interest,including Affiant,has in any way colluded,conspired, connived,or agreed,directly or indirectly with any other Proposer/Proposer,firm,or person to submit a collusive or sham Proposal/Proposal,or has in any manner,directly or indirectly, sought by agreement or collusion or communication or conference with any other Proposer/Proposer,firm,or person to fix the price or prices in the attached Proposal/Proposal or of any other Proposer/Proposer,or to fix any overhead,profit,or cost element of the Proposal/Proposal price or the Proposal/Proposal price of any other Proposer/Proposer,or to secure through any collusion,conspiracy,connivance or unlawful agreement any advantage against the City or any person interested in the proposed Contract. ordinances or rules of the City,the provisions of Miami-Dade County Code Section 2-11.1,as applicable to City,or the provisions of Chapter 112,part III,Fla.Stat.,the Code of Ethics for Public Officers and Employees,such Proposer may be disqualified from furnishing the goods or services for which the Proposal or Proposal is submitted and may be further disqualified from submitting any future proposals or Proposal for goods or services to City. 34 of 92 14 386672 Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List,or engaged with business operations in Cuba or Syria during the term of the Agreement. 3.The Proposer agrees to observe the above requirements for applicable subcontracts entered into for the performance of work under the Agreement that may result from this RFP.As provided in Subsection 287.135(8),F.S.,if federal law ceases to authorize the above-stated contracting prohibitions then they shall become inoperative. Proposer Initials Drug-Free Workplace Affidavit Proposer hereby recognizes that,pursuant to F.S.§287.087,preference shall be given to businesses with drug-free workplace programs when two proposals/Proposal are equal with respect to price,quality,and service.Proposer understands that in order to qualify as a drug-free workplace,Proposer must: a)Publish a statement notifying employees that the unlawful manufacture,distribution, dispensing,possession,or use of a controlled substance is prohibited in the workplace and specifying the actions that will be taken against employees for violations of such prohibition. b)Inform employees about the dangers of drug abuse in the workplace,the Proposer’s policy of maintaining a drug-free workplace,any available drug counseling,rehabilitation,and employee assistance programs,and the penalties that may be imposed upon employees for drug abuse violations. 1)Give each employee engaged in providing commodities or contractual services under the RFP a copy of the statement specified in subsection (1). 2)Notify employees that,as a condition of working on the commodities or contractual services under the RFP,the employee must abide by the terms of the statement and will notify the employer of any conviction of,or plea of guilty or nolo contendere to,any violation of chapter 893 or of any controlled substance law of the United States or any state,for a violation occurring in the workplace no later than five (5)days after such conviction. 3)Impose a sanction on,or require the satisfactory participation in a drug abuse assistance or rehabilitation program if such is available in the employee’s community,by any employee who is so convicted. 4)Make a good faith effort to continue to maintain a drug-free workplace through the implementation of this section. Based on information and belief,the statement,which I have marked below,is true in relations to the entity submitting this sworn statement. (INDICATE WHICH STATEMENT APPLIES.) IX The entity submitting this sworn statement is a drug-free workplace and is in full 35 of 92 15 387673 compliance with the requirements set forth under F.S.§287.087. The entity submitting this sworn statement is not a drug-free workplace. Proposer Initials City Non-Discrimination Requirements Affidavit Proposer understands that pursuant to Section 3-1.1 of the Code of the City of South Miami,the City will not enter into or award a contract to an entity engaged in a boycott. Proposer understands that “Boycott”as defined under Section 3-1.1 of the Code of the City of South Miami means to blacklist,divest from,or otherwise refuse to deal with a nation or country, or to blacklist or otherwise refuse to deal with a person or entity when the action is based on race, color,national origin,religion,sex,gender identity,sexual orientation,marital or familial status, age,or disability in a discriminatory manner.The term boycott does not include a decision based upon business or economic reasons,or boycotts,embargoes,trade restrictions,or divestments that are specifically authorized or required by federal law or state law. Proposer certifies that it is not engaged in a boycott,and is in full compliance with Section 3-1.1 'ode of the City of South Miami. Proposer Initials Acknowledgment,Warranty,and Acceptance 1.Contractor warrants that it is willing and able to comply with all applicable state of Florida laws,rules and regulations. 2.Contractor warrants that it has read,understands,and is willing to comply with all requirements of RFP No.FN2024-03 and any addendum/addenda related thereto. 3.Contractor warrants that it will not delegate or subcontract its responsibilities under an agreement without the prior written permission of the City Commission or City Manager,as applicable. 4.Contractor warrants that all information provided by it in connection with this Proposal is true andaccurate. Proposer Initials [REMAINDER OF PAGE LEFT INTENTIONALLY BLANK. SIGNATURE PAGE FOLLOWS.] 36 of 92 16 388674 In the presence of: Witness #1 Print l^ame:Shanb'Losey' Witness #2 Print Name:Carrie Hughes Print Name:Daniel Niswonger Title:President (Manager) State of Flertda Ohio County of Franklin ACKNOWLEDGMENT The foregoing instrument was acknowledged before me by means of X physical presence or _ online notarization,this 20th day of January ,2025 ,by Daniel Niswonger (name of person)as President (Manager)(type of authority)for Marsden South,LLC (name of party on behalf of whom instrument is executed). X Personally known to me;or Produced identification (Type of Identification: ) Did take an oath;or Did not take an oath JACQUELINE S MOORE Notary Public State of Ohio My Comm.Expires January 3,2028 37 of 92 17 389675 FORM 4 DISPUTE DISCLOSURE Answer the following questions by placing an “X”after “Yes”or “No”.If you answer “Yes”, please explain in the space provided,or on a separate sheet attached to this form. 1.Has your firm or any of its officers,received a reprimand of any nature or been suspended by the Department of Professional Regulations or any other regulatory agency or professional associations within the last five (5)years? YES NO X 2.Has your firm,or any member of your firm,been declared in default,terminated or removed from a contract or job related to the services your firm provides in the regular course of business within the last five (5)years? YES NO X 3.Has your firm had against it or filed any requests for equitable adjustment,contract claims, Proposal protests,or litigation in the past five (5)years that is related to the services your firm provides in the regular course of business? YES NO X If yes,state the nature of the request for equitable adjustment,contract claim,litigation,or protest, and state a brief description of the case,the outcome or status of the suit and the monetary amounts of extended contract time involved. I hereby certify that all statements made are true and agree and understand that any misstatement or misrepresentation of falsification of facts shall be cause for forfeiture of rights for further consideration of this Proposal or Proposal for the City of South Miami. ACKNOWLEDGMENT State of FfcridaOhio County of Franklin The foregoing instrument was acknowledged before me by means of KI physical presence or online notarization, this 20th day of January ,20 25 .by Daniel Niswonger (name of person) as President (Manager)(type of authority)for Marsden South,LLC (name of party on behalf of whom instrument is executed).J/1 _ X Personally known to me;or Produced identification (Type of Identification:. Did take an oath;or Did not take an oath JACQUELINE S MOORE Notary Public State of Ohio My Comm.Expires January 3,2028 38 of 92 FORM 5 CERTIFICATION REGARDING DEBARMENT, SUSPENSION, AND OTHER RESPONSIBILITY MATTERS PRIMARY COVERED TRANSACTIONS This certification is required by the regulations implementing Executive Order 12549, Debarment and Suspension, 13 CFR Part 145. The regulations were published as Part VII of the May 26, 1988 Federal Register (pages 19160-19211). Copies of the regulations are available from local offices of the U.S. Small Business Administration. (1)The prospective primary participant certifies to the best of its knowledge and belief that it and its principals: (a) Are not presently debarred, suspended, proposed for disbarment, declared ineligible, or voluntarily excluded from covered transactions by any Federal department or agency; (b) Have not within a three-year period preceding this application been convicted of or had a civil judgment rendered against them for commission of fraud or a criminal offense in connection with obtaining, attempting to obtain, or performing a public (Federal, State, or local) transaction or contract under a public transaction; violation of Federal or State antitrust statutes or commission of embezzlement, theft, forgery, bribery, falsification or destruction of records, making false statements, or receiving stolen property; (c) Are not presently indicted for or otherwise criminally or civilly charged by a governmental entity (Federal, State, or local) with commission of any of the offenses enumerated in paragraph (1)(b) of this certification; and (d) Have not within a three-year period preceding this application had one or more public transactions (Federal, State, or local) terminated for cause or default. (2)Where the prospective primary participant is unable to certify to any of the statements in this certification, such prospective primary participant shall attach an explanation to this Statement of Qualifications. Business Name_________________________________________________________ Date_________________________ By: Signature of Authorized Representative Name and Title of Authorized Representative 39 of 92 Marsden South, LLC Mark Dorenkott, President 1/20/2025 18 390676 FORM 6 PROPOSER’S QUALIFICATIONS SURVEY COMPANY QUALIFICATIONS QUESTIONNAIRE Please complete this Company Qualifications Questionnaire. By completing this form and submitting a response to the RFP, you certify that any and all information contained in the Proposal is true, that your response to the RFP is made without prior understanding, agreement, or connections with any corporation, firm or person submitting a response to the RFP for the same materials, supplies, equipment, or services, is in all respects fair and without collusion or fraud, that you agree to abide by all terms and conditions of the RFP, and certify that you are authorized to sign for the Proposer’s firm. Some responses may require the inclusion of separate attachments. Separate attachments should be as concise as possible, while including the requested information. In no event should the total page count of all attachments to this Form exceed five (5) pages. Some information may not be applicable; in such instances, please insert “N/A”. Firm Name Principal Business Address Telephone Number Facsimile Number Email Address Federal I.D. No. or Social Security Number Municipal Business Tax/Occupational License No. FIRM HISTORY AND INFORMATION How many years has the firm has been in business under its current name and ownership? Please identify the Firm’s document number with the Florida Division of Corporations and date the Firm registered/filed to conduct business in the State of Florida: Document Number Date Filed Please identify the Firm’s category with the Florida Department of Business Professional Regulation (DBPR), DBPR license number, and date licensed by DBPR: Category License No. Date Licensed 40 of 92 Marsden South, LLC 12501 Reed Road, Sugar Land, TX 77478 305-340-7524 888-788-0084 sali@marsden.com 46-4325823 11 M14000000069 12/30/2013 19 391677 Please indicate the type of entity form of the Firm (if other, please describe): □ Individual □ Partnership □ Corporation □ LLC □ LLP □ Other Please identify the Firm’s primary business: Please identify the number of continuous years your Firm has performed its primary business: Please list all professional licenses and certifications held by the Firm, its Qualifier/Principal, and any Key Staff, including any active certifications of small, minority, or disadvantaged business enterprise, and the name of the entity that issued the license or certification: License/Certification Type Name of Entity Issuing License or Certification License No. License Issuance Date Please identify the name, license number, and issuance date of any prior companies that pertain to your Firm: License/Certification Type Name of Entity Issuing License or Certification License No. License Issuance Date Please identify all individuals authorized to sign for the entity, their title, and the threshold/level of their signing authority: Authorized Signor’s Name Title Signing Authority Threshold (All, Cost up to $X-Amount, No Cost, Other) Please identify the total number of Firm employees, managerial/administrative employees, and identify the total number of trades employees by trade (e.g., 20 electricians, 5 laborers, 2 mechanics, etc.): Total No. of Employees Total No. of Managerial/Administrative Employees Total No. of Trades Employees by Trade INSURANCE INFORMATION Please provide the following information about the Firm’s insurance company: Insurance Carrier Name Insurance Carrier Contact Person 41 of 92 X commercial janitorial 65 N/A N/A Mark Dorenkott President All Daniel Niswonger President Marsden Services -- All 866 43 0 823Service Workers Marsh & McLennan Agency, Inc. Veronica Lawrence, AINS, ARM 20 392678 Insurance Carrier Address Telephone No. Email Has the Firm filed any insurance claims in the last five (5) years? □ No □ Yes If yes, please identify the type of claim and the amount paid out under the claim: FIRM OWNERSHIP Please identify all Firm owners or partners, their title, and percent of ownership: Owner/Partner Name Title Ownership (%) Please identify whether any of the owners/partners identified above are owners/partners in another entity: □ No □ Yes If yes, please identify the name of the owner/partner, the other entity’s name, and percent of ownership held by the stated owner/partner: Owner/Partner Name Other Entity Name Ownership (%) RECENT CONTRACTS Please identify the five (5) most recent contracts in which your Firm has provided services to other public entities: Public Entity Name Contact Person Telephone No. Email Address Date Awarded By signing below, Proposer certifies that the information contained herein is complete and accurate to the best of Proposer’s knowledge. Firm: Authorized Signature: Date: Print or Type Name: Title: 42 of 92 6160 Golden Hills Dr, Minneapolis, MN 55416 763-746-8000 Marsdencertificates@marshmma.com Manager Managed corporation Marsden Holding, LLC 100% X Marsden South, LLC 100% Scioto Services, LLC 100% Marden Services, LLC 100% 1 Stone Solutions, LLC 100% Marsden Central, LLC 100% Marsden Mechanical, LLC 100% Marsden South, LLC Mark Dorenkott President X Evon Parker v. Marsden South, L.L.C. et al., Court File No. 2021-57199 (Tex. Dist. Ct. 2022) (slip and fall claim; settled) City of Fort Lauderdale Kevin Kochersperger 954-828-5873 kkochersperger@fortlauderdaile.gov May 1, 2024 City Pembroke Pines Amelia Mohamed 954-961-6067 amohamed@ppines.com April 1, 2024 City of Miami Springs Amy Jaime 305-805-5054 jaimea@miamisprings-fl.gov Aug 1, 2023 Broward College Marcus Wilson 954-201-6974 mwilson2@broward.edu July 1, 2022 The City of Cooper City Dawn Deland 954-434-2300 ddeland@coopercityfl.org March 1, 2019 1/20/2025 21 393679 FORM 7 PRICE PROPOSAL Pricing shall be submitted in accordance with the Scope of Services, Section 3. NOTE: OVER THE TERM OF THE AGREEMENT, THE CITY RESERVES THE RIGHT TO ADD OR DELETE SERVICE AREAS, DEPENDING UPON CONDITIONS. IN THOSE CASES, THE ANNUAL FEE WILL BE ADJUSTED A. ANNUAL FEE YEAR ANNUAL FEE Year 1 $ Year 2 $ Year 3 $ Year 4 (Option Year) $ Year 5 (Option Year) $ TOTAL$ B. SCHEDULE OF VALUES FOR THE ANNUAL FEE Sylva Martin and Porch; City Hall (1st & 2nd Floor); Police Department (1st & 2nd Floor) $ Community Center (Multi-Purpose, Arts & Crafts Computer Lab & Education Room)$ Indoor Basketball Gymnasium/Bleachers $ Marshall Williamson building, commonly known as Mobley building $______________________ 43 of 92 91,964.58 94,723.52 94,723.52 94,723.52 31,599.00 26,608.16 5,401.78 13,454.05 89,285.57 465,420.71 22 394680 USING THE “SCHEDULE OF VALUES”MATRIX BELOW. Senior Citizens Center $ Public Works $ Dante Fascell Park $______________________ Firm: Authorized Signature: Date: Print or Type Name: Title: 44 of 92 4,971.66 3,759.71 3,491.21 Marsden South Shazard Ali January 22, 2025 Director of Business Development 23 395681 FORM 8 REFERENCE LIST IN ADDITION TO THE INFORMATION REQUIRED ON THIS FORM, PROPOSER SHALL PROVIDE A MINIMUM OF FOUR (4) REFERENCE LETTERS. REFERENCE #1 Public Entity Name: Reference Contact Person/Title/Department: Contact Number & Email Public Entity Size/Number of Residents/Square Mileage: Event(s) Completed (include Name of Project/Event, Date of Event Start/Completion, Details on Size/Scope of Work/Complexity) Is the Contract still Active? Yes No 45 of 92 The City of Miami Springs Amy Jaime/Procurement Specialist/Procurement 305-805-5054 jaime@miamisprings-fl.gov 90,000 Square Feet- 6 locations and 8 buildings Janitorial Services for all city buildings. We stared the contract in August of 2023 and is a current ongoing client. X 24 396682 REFERENCE #2 Public Entity Name: Reference Contact Person/Title/Department: Contact Number & Email Public Entity Size/Number of Residents/Square Mileage: Event(s) Completed (include Name of Project/Event, Date of Event Start/Completion, Details on Size/Scope of Work/Complexity) Is the Contract still Active? Yes No 46 of 92 Broward College Marcus Wilson/Vice President of Facilities/Collegewide Maintenance 954-201-6974 mwilson2@broward.edu 2 Campuses with 1,000 plus students and faculty. Janitorial services 3 shifts including day porters and exterior ground X cleaning over 1 million square feet and approximately 80 buildings. We started services in July 2022 and is currently servicing the 2 campuses. 25 397683 REFERENCE #3 Public Entity Name: Reference Contact Person/Title/Department: Contact Number & Email Public Entity Size/Number of Residents/Square Mileage: Event(s) Completed (include Name of Project/Event, Date of Event Start/Completion, Details on Size/Scope of Work/Complexity) Is the Contract still Active? Yes No 47 of 92 The City of Cooper City Dawn Deland/Senior Admin Specialist/Facilities 954-434-2300 ddeland@coopercityfl.org 40,000 Square Feet Janitorial Services for Public works, community center, city X hall and parks and recreation. We serviced the city from March 2019 to March 2023. 26 398684 REFERENCE #4 Public Entity Name: Reference Contact Person/Title/Department: Contact Number & Email Public Entity Size/Number of Residents/Square Mileage: Event(s) Completed (include Name of Project/Event, Date of Event Start/Completion, Details on Size/Scope of Work/Complexity) Is the Contract still Active? Yes No 48 of 92 The City of Fort Lauderdale Kevin Kochersperger/Facilities Manager/Facility Department 954-828-5873 kkochersperger@fortlauderdale.gov 24 City Buildings throught Fort Lauderdale May of 2024 and is currently serving all buildings. X Janitorial Services for all city buildings. We started the contract in 27 399685 FORM 9 KEY STAFF & PROPOSED SUBCONTRACTORS KEY STAFF required, please copy/duplicate this page and attach to this Form. Additional space: Name Title Years of Experience Years with Firm Licenses/Certifications qualifications than the Key Staff they will substitute for where substitute is required due to attrition, turnover, or a specific request by the City: 49 of 92 Ayza Mendoza Operations Manager 12 years 10 years Richard Wilson Senior Operations Manager 30 years 5 years Shazard Ali Director of Business Development 13 years 21 years team of supervisors and specialty technicians that can substitute for Ayza. Bill Ellis can also substitute for Richard Wilson and Mark Dorenkott our President can substitute for Richard for vacations and PTO. We also We have other Operation Managers in South Florida, Shaday Cleare and Bill Ellis along with a have another Business Development Manager that can substitute for Shazard Ali. Marsden has a team of HR specialist that provide support to all departments. 28 400686 Please complete the following chart with the Firm’s proposed Key Staff.If additional space is No Yes Please explain the Firm’s ability and resources to substitute personnel with equal or higher Key Staff Name Area of Responsibility Client Commitment (Hours/week) Period of Engagement PROPOSED SUBCONTRACTORS The undersigned Proposer hereby designates, as follows, all major subcontractors whom they propose to utilize for the major areas of work for the services. The bidder is further notified that all subcontractors shall be properly licensed, bondable, and shall be required to furnish the City with a Certificate of Insurance in accordance with the contract general conditions. Failure to furnish this w.) Subcontractor Name & Address Scope of Work License Number Firm: Authorized Signature: Date: Print or Type Name: Title: 50 of 92 Ayza Mendoza South Florida 8 hours Monday to Friday Richard Wilson South Florida 2 hours Monday to Friday Shazard Ali South Florida 1 hour First 90 days Operations Leadership Client Relations NA we will self perform the work 100% Marsden Soutth Shazard Ali January 22, 2025 Director of Business Development 29 401687 Please identify each Key Staff member’s engagement commitments that will exist concurrently with the City’s Services: information shall be grounds for rejection of the bidder’s proposal.(If no subcontractors are proposed,state “None”on first line belo I came to Marsden with over 20 years of experience in customer service and account management. I have experience in quality, employee and facility management. I have been with Marsden since 2017 and currently oversee the North Miami and West Palm Beach operations. My focus has been on delivering service excellence and measuring employee success. I have a beautiful family formed 35 years ago and with 3 wonderful children of 34, 27 and 20, I love to celebrate each special date of our lives. I enjoy cooking and spending time at home. And my best hobby is decorating and organizing any party to celebrate. 30 402688 Richard Wilson Bio With over 30 years of dedicated experience in the cleaning industry and more than 20 years in management, I have cultivated vast expertise in delivering quality service and fostering team growth. I began my career in Minneapolis, MN, and have spent the last eight years thriving in South Florida, where I continue to lead and innovate within the field. Outside of work, I cherish spending time with my family and exploring the great outdoors. Camping and nature have always been passions of mine, and I’ve recently discovered a love for Cruise Ships, which has opened up new horizons for adventure. A devoted fan of sports, I proudly support the Minnesota Vikings and Wild. I look forward to what the future holds, both professionally and personally! 31 403689 Shazard Ali, Director of Business Development Shazard Ali joined the Marsden South team as the Director of Business Development in 2013. During his tenure, Shazard has had many achievements at Marsden. In 2016 he won the Skip Marsden Outstanding Performance Award for his business development and client relations performance. In 2017 Shazard was named a Marsden Ambassador and a member of the President’s Club for outstanding performance. In the past decade, he has been in the top 5 in the country when it comes to achieving goals and quotas. Shazard comes to the Marsden team from World Emblem where he was a Regional Sales Manager. Prior to World Emblem, Shazard worked in the janitorial and facility services industry with Crestwood Services and Coverall Cleaning Concepts. At Crestwood Shazard was Director of Sales and Business Development with a focus on growth for the company and building a Sales team during 2009 to 2012. At Coverall, Shazard was Regional Director for the Pembroke Pines office during 2003 to 2008. Shazard attended Broward College and resides in Hollywood, Florida with his soon-to-be fiancé. 32 404690 The City of South Miami Safety HR Work Order Center Administrative Partners Shazard Ali – Business Development Executive Richard Catchman President Business Development Organization & Management Structure Mark Dorenkott President Ric Wilson Senior Operations Manager Florida Project Managers Ayza Mendoza/Shaday Cleare Day time Janitors Nighttime Janitor 33 405691 M MARSDENFSOUTH Marsden was established in 1952 and today, we operate as a full-spectrum facility services provider. Every day, our associates support thousands of clients with quality-based, customer-focused solutions. We provide clients across the country with clean, safe, and healthy workplaces. About Marsden Services We are building a culture of excellence, consistency, and a passion for finding new ways to raise the bar in how we are caring for your workplace. Marsden provides clients with a unique combination of national strength and local presence. Despite our size, our focus is on the local markets. Each local Marsden management team is invested in its community and local clients, providing personalized service. Our local teams leverage our resources as a large organization – including technology, equipment, supplies, subject matter experts, and financial support – to better serve their clients. Through our combined national and local operations, we provide our clients with the strength of a large corporation and the individualized care of a small business. © 2021 Marsden Services www.marsden.com ABOUT US We think and operate differently in the way we care for our client’s workplaces. Serving in leadership roles for several industry associations, we learn early about the top issues and challenges effecting building environments and use that knowledge to better support our clients and care for their facilities. Caring for your workplace ® Founded in 1952 in St. Paul, MN by Skip Marsden 5 service lines: Janitorial, Security, Mechanical, Emergency Services, and Facility Management Over 9,000 employees operating out of more than 55 office locations 350M sq ft of commercial space serviced every day 34 406692 MMARSDEN HOLDING WE ARE RELATIONSHIP BUILDERS Relationships drive everything we do, and we approach each relationship with empathy and integrity. We get to know and value the needs, motivations, goals, and priorities of everyone we work with, whether it’s clients, associates, stakeholders, community partners, or vendors. WE ARE CONSTANT ADVANCERS We strive for growth in every area of our business. We aim to operate profitably so that we can continue developing, expanding, and taking on new challenges. As we grow our business to better serve our clients, we encourage associates to grow in their careers and help them to develop professionally and personally. WE ARE SOLUTION SEEKERS When we see a problem or a need, we find the solution. We’re always searching for new ways to solve problems for our customers, our industry, and our community. This has led to expanding our service lines, implementing new technologies, deploying new products, and forming key partnerships. WE ARE POSITIVE INFLUENCERS We are intentional about having a positive impact through our work. We create cleaner, safer, and healthier workplaces; we make our clients’ jobs easier; we invest in an inclusive workplace and associate wellbeing; and we donate 10% of pre-tax profits to help support our community. RELATIONSHIP BUILDERS SOLUTION SEEKERS POSITIVE INFLUENCERS CONSTANT ADVANCERS Marsden is one of the founding members of the Cleaning Coalition of America (CCA). The CCA was established in 2020 to represent commercial cleaning companies and their employees. The CCA advocates on behalf of commercial janitorial workers, who are members of the essential services workforce and who play a vital role in keeping communities safe and healthy through important cleaning and disinfecting services. Marsden is one of the founding members of the Cleaning Coalition of America. Our Core Values Industry Associations Marsden is actively involved in several industry associations, including the Building Service Contractors Association International (BSCAI); Building Owners and Managers Association International (BOMA); International Facility Management Association (IFMA); and the Cleaning Coalition of America. Marsden also holds a national APPA membership. By serving in leaderships roles for these industry associations, we learn early about the top issues and challenges facing building environments and have first access to new best practices, technologies, and solutions for our clients. © 2021 Marsden Services www.marsden.com ABOUT US 35 407693 Cleaning Coalition of America MARSDEN Our goal through our charitable giving initiatives is to enrich and build strong communities. We do this by creating partnerships with charitable organizations and matching our resources with the needs of the community. We believe in funding programs that support opportunities for people to become well-educated and self-sufficient, leading to healthier communities and greater individual success. Marsden seeks out organizations that are creative, proactive, innovative, and results-oriented. The majority of Marsden grants are awarded in communities in which Marsden and its affiliates do business. We make it our mission to fund projects and programs that build Marsden communities and make them better places to live, work, and raise families. We encourage and support our employees’ efforts to become volunteers, board members, and committee chairs with local nonprofits. Our Commitment to Community Early Childhood Education Programs/projects that provide high-quality experiences for pre-school-aged children that result in enhanced social skills and school readiness. Youth Development Programs/projects that promote healthy social and academic development of youth, with an emphasis on fostering their aspirations to stay in school and pursue higher education or vocational training. Workforce Development Programs/projects that strengthen the workforce in our communities to position and prepare under/unemployed individuals for career advancement and greater self-sufficiency. Community Revitalization Programs/projects aimed at increasing the vitality of economically disadvantaged neighborhoods, such as the development of small businesses, affordable housing, and/or other important community assets such as community centers. Although we donate to several different causes, we have four key areas of focus. © 2021 Marsden Services www.marsden.com CHARITABLE GIVING Since 1952, Marsden Services has been deeply embedded in the communities we serve. Our founder, Skip Marsden, established a legacy of generosity and stewardship that we continue to live out today. 70 Years of Giving 36 408694MARSDEN © 2021 Marsden Services www.marsden.com Our goal is to be transparent, collaborative, and responsive. A core part of Marsden’s operating model is empowering our local leadership teams with the autonomy to provide the highest level of service. As part of this practice, we always provide our clients with the names and contact information of their local Marsden leadership. Our local team is available to answer questions, address concerns, respond to requests, and to respond to emergency needs. Comprehensive Communication Direct Contact Clients are always given their account manager’s contact information. Clients can also request scheduled calls. Reports & Surveys We can provide results from inspection reports and clients can send us surveys and reviews of our service performance. We believe that intentionally initiating communication establishes better partnerships as we improve our understanding of your priorities and develop the ability to anticipate your facility needs. Marsden takes a proactive approach to managing communications. COMMUNICATION We have multiple communication platforms in place and tailor our com- munications to our clients, their teams, and their needs. Meetings Meetings can be scheduled at regular intervals or upon request and can include various representatives from our team and the client’s team. Onsite Visit We can meet with clients onsite during site inspections, site visits, client tours, or for other onsite events. Client Portal We can create a customized client portal that allows you to see inspection reports, service schedules, and real-time metrics. Client Care Center Our clients have 24/7/365 access to our Client Care Center for service requests, crisis situations, and questions. 37 409695 0 MARSDEN © 2021 Marsden Services www.marsden.com HIRING PRACTICES We hire with an eye on building a long-term team. Marsden seeks to not only hire the best staff, but to retain our associates and help them grow in their careers at our company. Strengthening our culture by recruiting, hiring, and retaining the best associates. Hiring Methods Marsden has a unique approach to hiring. We combine recruiting, hiring, and onboarding practices that blend the speed and efficiency of technology and e-onboarding with the personal touch of face-to-face interactions. Our comprehensive hiring process guarantees our clients get qualified long-term associates, increased productivity, and the highest level of quality in the way we care for our client’s workspaces. Our intensive screening and hiring processes go well beyond industry standards because we know that finding the best associates to care for your workplace is what distinguishes Marsden from its competitors. Our hiring is done by our HR Talent Acquisition Specialists, who are experts in current employment laws, verifying authorization to work documents, running E- verify checks, performing background checks, and interviewing candidates. Marsden’s careful hiring process results in a quality workforce that is highly trained, trustworthy, and motivated. Talent Acquisition The Talent Acquisition Specialists create well-defined job descriptions. They advertise positions on online platforms, social media, community outreach, and a successful referral rewards program with our existing staff. We find the best applicants and review their qualifications. 1 38 410696 MARSDEN Screening We vet each applicant’s eligibility, legal status, work history, and background. We also implement additional screening measures dependent upon specific job and client requirements, including drug and alcohol testing, driver’s record checks, strength testing, and education verification. 2 Interviewing Qualified applicants participate in personal, face-to-face interviews that cover general suitability, job experience, and work ethic. With a combination of standard questions and position-specific discovery, our experts can effectively determine if the candidate will succeed and remain with Marsden for the long term. 3 Hiring Marsden seeks associates interested in long-term opportunities with our company. During the hiring process, we provide associates with the training they will need to be successful in their Marsden careers. During onboarding, employees get to know Marsden’s culture and goals. 4 Retaining We engage our associates and help them grow in their careers. We provide competitive wages and benefits; promotions, training, and opportunities; recognition and awards programs; and associate engagement and care programs. 5 Internal Promotions Strategy Promoting from within is not just a best practice; it is a promise we make to our associates. Over 70% of our management personnel have been hired internally through promotions. We believe our associates stay committed when they see we are committed to helping them advance and reach their goals. Marsden’s internal promotions program, STEPS, clearly defines the requirements for advancement in the company. Marsden developed the STEPS program to provide our employees with an outline for career development. STEPS assigns each position a set of skills that must be mastered before moving to the next level. We provide training for associates who want to become qualified for a new position. © 2021 Marsden Services www.marsden.com HIRING 39 411697MMARSDEN © 2021 Marsden Services www.marsden.com TRAINING We investigate the best products, equipment, methods and cleaning systems, using the latest research and best practices to develop our training and quality assurance programs. Every Marsden team represents hundreds of hours of training and education. New Associate Training Every new Marsden associate goes through a multi-step training process. The result is a workforce that is knowledgeable, efficient, consistent, and highly skilled. Step One: Classroom Training The first portion of the training program takes place at one of our offices. Classroom training focuses on company policies and procedures, associate “Right to Know” information, safe use of all products and equipment, and environmentally conscious cleaning techniques. There are test questions after each section to ensure comprehension. 1 Step Three: Technical Training The final stage in our training program is for associates begin their onsite technical training, which includes standardized cleaning methods, site-specific training, equipment training, periodic work training, safety protocols, human resources policies, and customer service training. Step Two: Procedural Training Associates receive one-on-one instruction during procedural training. During the hands-on training, a designated trainer works alongside the new associate. As they clean, the new associate is taught Teach Easy Cleaning Habits (TECH), Marsden’s unique cleaning system. 3 2 40 412698 How it works Tasks TECH specifies everything that needs to be done and the order in which to perform each task. Route Associates are taught the most efficient path and cleaning method for each area. Supplies TECH incorporates the best equipment and chemicals to use for each application. Consistency TECH eliminates variables from one associate to the next, ensuring uniform performance. Efficiency TECH’s best practice method for cleaning each area ensures time and energy are not wasted. Ownership Associates understand their responsibilities and how their work contributes to the overall success of the team. Why it matters © 2021 Marsden Services www.marsden.com In addition to the initial training programs, all of our staff are expected to complete ongoing training and annual refresher training courses. Our labor management software system has a compliance component to track training. Our system monitors and records that team members have received the proper training and certifications for their positions. The system automatically informs management of upcoming training due dates and provides alerts for past due items. TECH System and Training Marsden’s Teach Easy Cleaning Habits (TECH) program is a proprietary system designed to ensure reliable quality standards. TECH teaches new associates our standard cleaning system as well as the specific scope of work for the account where the associate will be working. TRAINING 41 413699MARSDEN © 2021 Marsden Serviceswww.marsden.comMarsden's management processes continually monitor associate compliance with our uniform and appearance policies ensuring clean, well-groomed personal appearance on every client job site.• Daytime associates• Nighttime associatesProfessional Standards We offer high-quality uniforms to our associates free of charge. They are required to wear uniforms and photo identification cards whenever they are on the job. Our uniforms serve as identification and ensure our associates make a positive impression and provide a higher level of security for our clients. If an associate leaves our employment, we hold their last paycheck until they return their identification card.We can customize our uniforms to meet specific client requests and correspond with associate job responsibilities. Our uniforms typically cover four types:• Project specialists• ManagementUNIFORMS & IDENTIFICATIONOur associates must maintain high professional standards in every aspect of work. We require our associates to maintain uniform and appearance standards and accountability when providing care for our client's workplaces. 42414700N3GSHVIAI W © 2021 Marsden Services www.marsden.com SAFETY FIRST Our national environmental health and safety leadership team monitors and introduces initiatives to ensure our associates receive the latest safety training to come to work careful, alert, prepared to provide clients with cleaner, safer and healthier workplaces. Our goal is ZERO injuries. Marsden has a culture of safety, and every associate is passionate about providing our clients and our staff with a safe and healthy environment. Marsden associates make safety part of their lifestyle and integral to every task and operation they perform. Marsden’s Safety360 program is a behavior-based program supporting associate well-being. The Safety360 program is a comprehensive, proactive, and multidimensional initiative that our national and local safety leadership teams use to build a company-wide safety culture. Marsden’s Safety360 Program . We focus on prevention-based activities to ensure Safety360's success. Safety360 includes the following vital fundamental elements: • Behavior-based program of risk exposure, hazard identification , incident prevention, and rewards • Well established and communicated goals • Mandatory Personal Protective Equipment requirements • Daily pre-shift hazard identification and control conferences • Continuous task-specific training • Developing field safety leaders as crucial extensions of the Safety360 program • Near-miss incident reporting and investigation • Detailed incident investigation and root cause analysis • Scheduled safety audits 43 415701 MARSDEN © 2021 Marsden Services www.marsden.com Hazard Control Methods As a fundamental practice, we adhere to the hazard control methods established by the National Institute for Occupational Safety and Health (NIOSH): Substitution Replace the hazard Engineering Controls Isolate people from the hazard Admin Controls Change the way people work PPE Protect associates with PPE Elimination Physically remove the hazard Continuous Safety Training Training is the key to creating and maintaining safety awareness throughout our company. Marsden's Safety360 program provides ongoing training for our associates, continuing throughout their careers. Associates receive safety awareness training upon hire, where they are required to review Marsden Services' Cardinal Rules of Safety, sign the Safety Pledge, and complete Employee Right-to-Know training. Following this initial training, associates receive supplementary training on identifying and reporting workplace safety hazards before beginning work in their assigned accounts. For each account, we conduct a site-specific hazard analysis which leads to site-specific training protocols. Training is reinforced through daily safety briefings at the job site to provide ongoing protection for our associates and our clients. Our managers are a key to our consistent focus on safety. Every Marsden manager completes advanced-level safety training modules. During training, new managers review the full safety spectrum, from the basics of safe practices to the audit protocols following any safety incident. Supported by Marsden's compliance tracking technology applications, managers – including our safety directors, coordinators, and supervisors – are responsible for their associate's ongoing training and compliance. SAFETY FIRST 44 416702MARSDEN © 2021 Marsden Services www.marsden.com QUALITY CONTROL Marsden's quality assurance program comprises three key aspects: a thorough and proactive program, innovative technologies, and industry-leading labor management techniques. Quality assurance is the foundation to all aspects of our service delivery. Marsden empowers our associates to provide consistent, reliable, and customer-focused services. We are constantly exploring ways to improve the condition and value of each client facility. We use predictive analytics to provide consistent quality services while we continue to focus on containing costs for our clients. Before working in an account, our leadership team discusses priorities with our clients and together we determine key performance indicators (KPIs). Marsden’s Quality System Marsden’s quality control program covers nine key pillars. Timekeeping HR Access Health & Safety Project Calendar Reporting Customer Surveys Service Requests Inspections Work Order Tracking 45 417703 © 2021 Marsden Services www.marsden.com QUALITY CONTROL Our web-based quality control platform enables us to establish and monitor the necessary metrics to be successful, which includes the following: - Well-trained staff - Disinfection and cleaning results - Facility inspection performance scores - Service deficiency resolution - KPI compliance - Training levels - Safety program compliance - Customer engagement - Identifying opportunities for improvement - Cost containment Labor Management Marsden uses the latest mobile technology to streamline our HR efforts and efficiently manage our labor force from the field. From a mobile device, Marsden supervisors can manage people and projects from any location. Managers leverage mobile technology to: • Monitor associate departures and arrivals in real-time • Identify absences and contact available replacement team members • Communicate directly with team members • Perform site inspections and create reports • Ensure compliance with labor hours is delivered • View and fill open posts • Create, view, modify and share associates schedules • Monitor job schedules • Safety near-miss reporting • View associates pay stubs and hourly rates By using technology to streamline our HR efforts, our clients benefit from scalability and an increased level of efficiency and accountability. Timekeeping & Notifications and Human Resources Access 46 418704 Technology and Service Delivery Marsden uses a mobile project management system to track all service activities, manage work orders and specific service requests, and streamline communication with clients. The platform creates agility to accommodate the changing needs of our clients. Our work order service requests follow a simple five-step process that encompasses logging activities, providing progress communications, review and rapid escalation if necessary, and completion tracking and notification. Our procedures are monitored at the local and corporate levels, ensuring high levels of timely and quality follow-up. Marsden’s project management technology oversees a daily workload of periodic tasks occurring at various intervals. Leveraging their knowledge and experience, Marsden managers divide periodic tasks into reasonable and equal weekly workloads. Detailed weekly assignments ensure specific equipment and essential labor are available. We can also use this technology to track and identify areas for corrective action, including re-training, adding new associates, reformatting a schedule, new management, and/or adding equipment. Whenever a service request was a complaint, upon completion, we validate that we met client expectations and ask for feedback to ensure that service is again up to our client's standards. The corrective action plans are implemented into the project program, tracked for compliance, and documented in the project scope of work (SOW). © 2021 Marsden Services www.marsden.com Action items are first the responsibility of the account manager and are automatically escalated if they are not immediately reconciled at this level. Although we have a defined process for escalation, issues are almost always immediately resolved at the local level. LOCAL LEVEL AREA MANAGER DIRECTOR OF OPERATIONS CHIEF OPERATING OFFICER QUALITY CONTROL Service Requests, Work Order Tracking, and Project Calendars 47 419705 0 © 2021 Marsden Services www.marsden.com Marsden has three tiers of inspection, ranging from daily inspections done by onsite managers to quarterly formal inspections. Daily Informal Inspections Every day after each shift, onsite supervisory staff validate compliance with the tasks to be performed as outlined on the route card. Any discrepancies are corrected immediately. Monthly Formal Inspections The account manager performs monthly formal inspections. Client participation is optional. An official inspection form ensures each area of the facility is properly evaluated. Monthly inspection results are made available to the client. Quarterly Inspections Each account is inspected by an Operations Manager alongisde the account manager. Clients are invited to participate. Reports from these formal inspections are made available to all stakeholders. TIER 1 TIER 3 QUALITY CONTROL Quality Control Inspections and Reports Marsden's web-based and mobile quality assurance tools allow us to track and manage inspections. Our quality inspection platform is accessible to our associates via phone or tablet in the field. Mobility enables our managers to spend more time in the field, directly supervising the work done by our associates at each account. The quality assurance tool provides site-specific checklists and inspection forms and mobile devices can take photos and embed them in the inspection report. Our account managers can measure inspection reports against established quality goals and instantly respond with corrective actions, if necessary. We perform regular checkpoint inspections to review all aspects of Marsden's contract performance. Our client-established KPIs are given greater scoring weight, continually reinforcing our focus on the agreed-upon client priorities. During an inspection, we are examining the following aspects of our service performance: - Compliance with the SOW - Service levels by area category - Resolution of deficiencies - Disinfection effectiveness - Training effectiveness - Equipment readiness - Safety compliance - 5S Compliance Inspections TIER 2 48 420706 © 2021 Marsden Services www.marsden.com QUALITY CONTROL Transparent Metrics and Open Communication Every formal inspection report form is completed and logged in a centralized database. Our clients have access to all reporting. All client service requests are logged into our system and completion of that request is reported back to the client. Marsden can customize our reports to meet client KPI's and preferences. At the beginning of the contract period, we ensure that each client's KPIs are well understood by our team. We are performing a constant "gap analysis," which compares actual performance scores to the desired performance scores, which may result in a gap. If a gap exists between the actual and the desired level of service, we will continue to implement changes to improve performance until we have closed the gap. Client feedback is important to us. We can provide your stakeholders with a simple satisfaction survey on a quarterly basis. This survey helps us to measure our performance against client expectations. The surveys are customized to the KPIs of each specific program. Reports and Customer Surveys Site-Specific Safety Programs Our local management teams work with our clients to design and implement site-specific safety programs, tailoring training and stipulations to each environment. By doing so, we: - Create an accident-free culture - Ensure our employees go home as healthy as they arrived - Avoid property damage and increase the safety of client facilities - Provide safety assessments and near-miss reporting - Ensure compliance with all Federal and State regulatory requirements - Successful safety programs are an effective way to contain costs Environmental Health & Safety 49 421707MARSDEN © 2021 Marsden Services www.marsden.com With over 70 years of first -hand learning, Marsden's transition process has allowed us to perform thousands of successful account startups. TRANSITION PLAN Led by a team of cross-functional senior staff, implementation begins immediately upon notification of a contract award. Frequent and transparent communication is a central part of our process. The Transition Team The transition process starts with a thorough situational analysis,which we utilize to create a formal and systematic plan addressing specific needs and timelines.Our transition team includes professionals from HR,Operations,Sales,Training,Safety,and Administrative and Technical Services in order to ensure every detail is covered,including manpower,supplies,equipment,and all other essential resources.Our process is designed to ensure that transition phases and key dates are being met for a seamless startup.In our transition plan,we outline the essential activities to perform before,during,and after the transition.We customize our transition plan to meet specific client needs and timelines. New Start Checklist Job Site Name Job #Address Start Date City of South Miami TBD 6130 Sunset Drive, South Miami, Florida 33143 March 01, 2025 Start-Up Lead Coordinator Richard Wilson Sales Rep Shazard Ali Central Electronic File Location South Florida Office Ops Rep Ayza Mendoza The following transition plan is an outline for transitioning that anticipates 30 days'notice of service start,although Marsden can and has started service with less than 30 days'notice. 50 422708 © 2021 Marsden Serviceswww.marsden.comTRANSITION PLANScheduled TaskOwnerWeek Before StartPre4321Start DayPostSalesObtain official award notificationHave contract reviewed by LegalFinalize contract negotiationsHave contract signed and sentSend info to the Start-up TeamSchedule internal team meetingsSchedule client team meetingsAttend initial start day (if possible)Tour site morning after (if possible)Monitor client satisfactionAttend start team meetingsOperationsReview contract requirements & bid docsCreate preliminary staffing planSubmit initial staffing requestsTour site(s) to complete account checklistClarify if client wants any existing staffFinalize staffing plan & adjust reqsInterview management candidatesSelect management personnelSubmit equipment requestsSubmit supply requestsSubmit uniform requestsSubmit IT requestsAssign extra start-up managersFinalize schedules & job runs w/Admin 51423709 © 2021 Marsden Serviceswww.marsden.comTRANSITION PLANScheduled TaskOwnerWeek Before StartPre4321Start DayPostOperations (continued)Assign sections to start-up managersAssign staff to start-up managersCentrally coordinate all efforts start nightConfirm all areas checked and securedTour morning after with site clientMaintain extra support until settled inAttend start team meetingsAdmin Support / National ActivityFill out any client required formsSend COI and W-9 to clientConfirm exact billing requirementsSet up billing with accountingOrder IT equipment - phones, computersOrder office supplies (if needed)Set up task schedules / job descriptionsSet up web WO SystemSet up web Periodic SchedulesSet up web Inspection SystemProvide web tool training if neededMonitor web tools & alert mgmt if neededContinue to support as neededAttend start team meetingsHuman ResourcesReview contract requirementsObtain staffing requests from OpsZip code search current for transfers 52424710 © 2021 Marsden Serviceswww.marsden.comTRANSITION PLANScheduled TaskOwnerWeek Before StartPre4321Start DayPostHuman Resources (continued)Zip code search applicants on fileInterview selected existing site staffPursue new applicants as neededInterview/screen all new applicantsSchedule mgmt interviews with OpsReview transfer list with OpsCheck applicant referencesMake job offers to applicantsPerform reference/background checksSchedule drug testing (if required)Perform new employee orientation trainingIssue uniforms, badge, handbook, etc.Start early in existing site if possibleProvide final staffing list to OpsSet up staff for call in (if applicable)Adjust/replace new staff if neededAttend start team meetingsSecurityReview contract requirementsConfirm exact access requirementsCoordinate special requirements with HRCreate any custom documentationConfirm Ops has a full understandingFollow-up on any security concernsAttend start team meetings 53425711 © 2021 Marsden Serviceswww.marsden.comTRANSITION PLANScheduled TaskOwnerWeek Before StartPre4321Start DayPostSafetyReview contract requirementsConfirm exact site requirementsCoordinate special requirements with HRCoordinate MSDS complianceConfirm Ops has a full understandingFollow-up on any safety concernsAttend start team meetingsSupplyReview contract requirementsConfirm exact site requirementsReview Ops supply requests & orderConfirm delivery to staging areaOrganize and set up suppliesAssist with staff trainingFollow up on any supply concernsAttend start team meetingsEquipmentReview contract requirementsConfirm exact site requirementsReview Ops Equip Requests & orderConfirm delivery to staging areaOrganize and set up equipmentAssist with staff trainingFollow up on any equip concernsAttend start team meetings 54426712AtMARSDEN © 2021 Marsden Services www.marsden.com Water and Storm Damage Mitigation We focus on containment and mitigation to limit losses and prevent the spread of damage. We use the latest technologies to avoid intrusion into other areas while quickly and properly drying any affected areas, enabling you to you reopen your business without the concern of mold or long-term damage. Fire and Smoke Cleanup Smoke can cause more damage to a building than is visible to the naked eye. We use industrial hygienic testing to determine the path and penetration of the smoke and use our findings to design a plan for the cleaning process. After cleanup is complete, we test again to ensure the area is safe for re-entry. Mold and Asbestos Remediation Mold damage is dangerous both to the facility and its occupants. We eliminate mold rapidly and completely, controlling any risk of mold spreading to different areas of your building. Our experts know how to identify and remediate mold or asbestos issues quickly and safely. We employ hygienic testing pre and post-cleanup to ensure safe re-entry. Document Recovery Marsden's document processing laboratories can recover documents that would have otherwise been deemed a total loss. Our laboratories are equipped with specialized technologies to remove water or moisture to recover your essential documents. We also provide thorough security measures to protect the business information and offer secure destruction of restored or unretained files. Restore Your Facility to its Pre-Loss Condition We understand that speed is essential when responding to a facility emergency and we offer 24/7 emergency response services. We also understand that the correct response is imperative. Our experienced restoration teams have the expertise to determine exactly what needs to be done to restore your facility to its pre-loss condition. We also work with your business asset teams to inventory and claim any assets lost. EMERGENCY SERVICES Fast and professional services that get you back in business quickly and safely. Marsden’s restoration division offers commercial disaster recovery, reconstruction, and remediation services that are fast, efficient, and safety-focused. 55 427713MMARSDEN © 2021 Marsden Services www.marsden.com INTEGRATED SERVICES Facilities are complex environments, which is why Marsden provides integrated facility services. We support small and large businesses alike with comprehensive facility care. We get to know each of our clients individually and can provide a service package specific to their infrastructure and needs. Marsden offers a full spectrum of facility services to keep your facility clean, safe, and healthy. Instead of having multiple vendors to support different aspects of your facility, with Marsden, you can have a single provider to take care of all your facility needs. Marsden offers a seamless experience for your facility services. We provide a variety of service offerings, which support all aspects of facility operations and are divided into our five service lines. Marsden’s Five Service Lines JANITORIAL SECURITY MECHANICAL EMERGENCY RESPONSE Janitorial, disinfecting, carpet, window, floor, and other cleaning services Design and maintenance for HVAC equipment and electrical, plumbing and calibration services Uniformed guards, security technologies, investigations, remote guarding, and consulting services 24/7 disaster recovery and facility emergency services FACILITY SERVICES Comprehensive facility services for small to mid-sized buildings & campuses 56 428714MMARSDEN SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF, NOTICE WILL BE DELIVERED IN ACCORDANCE WITH THE POLICY PROVISIONS. INSURER(S) AFFORDING COVERAGE INSURER F : INSURER E : INSURER D : INSURER C : INSURER B : INSURER A : NAIC # NAME:CONTACT (A/C, No):FAX E-MAILADDRESS: PRODUCER (A/C, No, Ext):PHONE INSURED REVISION NUMBER:CERTIFICATE NUMBER:COVERAGES IMPORTANT: If the certificate holder is an ADDITIONAL INSURED, the policy(ies) must have ADDITIONAL INSURED provisions or be endorsed. If SUBROGATION IS WAIVED, subject to the terms and conditions of the policy, certain policies may require an endorsement. A statement on this certificate does not confer rights to the certificate holder in lieu of such endorsement(s). THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER. THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND, EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW. THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S), AUTHORIZED REPRESENTATIVE OR PRODUCER, AND THE CERTIFICATE HOLDER. OTHER: (Per accident) (Ea accident) $ $ N / A SUBR WVD ADDL INSD THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIOD INDICATED. NOTWITHSTANDING ANY REQUIREMENT, TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN, THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS, EXCLUSIONS AND CONDITIONS OF SUCH POLICIES. LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. $ $ $ $PROPERTY DAMAGE BODILY INJURY (Per accident) BODILY INJURY (Per person) COMBINED SINGLE LIMIT AUTOS ONLY AUTOSAUTOS ONLY NON-OWNED SCHEDULEDOWNED ANY AUTO AUTOMOBILE LIABILITY Y / N WORKERS COMPENSATION AND EMPLOYERS' LIABILITY OFFICER/MEMBER EXCLUDED? (Mandatory in NH) DESCRIPTION OF OPERATIONS below If yes, describe under ANY PROPRIETOR/PARTNER/EXECUTIVE $ $ $ E.L. DISEASE - POLICY LIMIT E.L. DISEASE - EA EMPLOYEE E.L. EACH ACCIDENT EROTH-STATUTEPER LIMITS(MM/DD/YYYY)POLICY EXP(MM/DD/YYYY)POLICY EFFPOLICY NUMBERTYPE OF INSURANCELTRINSR DESCRIPTION OF OPERATIONS / LOCATIONS / VEHICLES (ACORD 101, Additional Remarks Schedule, may be attached if more space is required) EXCESS LIAB UMBRELLA LIAB $EACH OCCURRENCE $AGGREGATE $ OCCUR CLAIMS-MADE DED RETENTION $ $PRODUCTS - COMP/OP AGG $GENERAL AGGREGATE $PERSONAL & ADV INJURY $MED EXP (Any one person) $EACH OCCURRENCE DAMAGE TO RENTED $PREMISES (Ea occurrence) COMMERCIAL GENERAL LIABILITY CLAIMS-MADE OCCUR GEN'L AGGREGATE LIMIT APPLIES PER: POLICY PRO-JECT LOC CERTIFICATE OF LIABILITY INSURANCE DATE (MM/DD/YYYY) CANCELLATION AUTHORIZED REPRESENTATIVE ACORD 25 (2016/03) © 1988-2015 ACORD CORPORATION. All rights reserved. CERTIFICATE HOLDER The ACORD name and logo are registered marks of ACORD HIRED AUTOS ONLY 12/18/2024 Marsh &McLennan Agency LLC 6160 Golden Hills Drive Minneapolis MN 55416 763-746-8000 MarsdenCertificates@marshmma.com Greenwich Insurance Company 22322 MARSDEN XL Insurance America,Inc.24554MarsdenSouth,LLC 11000 Wilcrest,Suite 125 Houston,TX 77099 Allied World National Assurance Company 10690 1160889533 A X 2,000,000 X 500,000 5,000 2,000,000 4,000,000 X X RGD943761812 1/1/2025 1/1/2026 4,000,000 A 5,000,000 X RAD943762012 1/1/2025 1/1/2026 C X X 10,000,000031410951/1/2025 1/1/2026 10,000,000 X 10,000 B B X N RWD943538912 (AOS) RWR943539012 (DE WI) 1/1/2025 1/1/2025 1/1/2026 1/1/2026 1,000,000 1,000,000 1,000,000 Workers Compensation policy (RWD943538912)includes Employers Liability coverage for the following Monopolistic States:Ohio,North Dakota,Washington and Wyoming Evidence of Insurance 57 429715 ACORD® Md*'' ADDENDUM No. 1 Project Name: JANITORIAL SERVICES RFP No. FN2024-17 Date: January 16, 2025 Sent: Fax/E-mail/webpage This addendum submission is issued to clarify, supplement and/or modify the previously issued Solicitation, and is hereby made part of the Documents. All requirements of the Documents not modified herein shall remain in full force and effect as originally set forth. It shall be the sole responsibility of the bidder to secure Addendums that may be issued for a specific solicitation. QUESTION #1 Will there be an opportunity to visit any of the sites on the bid? RESPONSE: A site visit/walkthrough/pre-bid is not scheduled at this time. Please refer to Attachment C, “Janitorial Service Locations Matrix,” and Attachment D, “Photographs of Floor Types in Service Areas,” in the solicitation for details of each facility identified for this project; including estimated Square Feet, Restrooms, Appliances, Sinks and Counters, Windows and Water Fountains. QUESTION #2: Who is the current contractor? RESPONSE: The current vendor is Clean Spaces, Inc. QUESTION #3: What is the current contract price being paid today? For each site? Date contract started? RESPONSE: The current monthly fee is $6,800 in total. We do not have a breakdown by each location. The current contract is based on a month-to-month basis. Please refer to the month-to-month agreement is attached to Addendum No.1. The current contract start date was October 1, 2021. QUESTION #4: Is the current contractor scope of work the same as the current bid scope of work? If not, what has changed? RESPONSE: No, the scope has changed from the current contract. New locations to the scope: • Indoor Basketball Gymnasium 58 430716 South 'Miami THE CITY OF PLEASANT LIVING • Dante Fascell Park – Restroom Facility QUESTION #5: How many hours per day per location does the cleaning crew work? RESPONSE: The number of hours worked is determined by the contractor and is based on the City’s requirements published in the Scope of Services. QUESTION #6: For Strip & Wax jobs, How many coats of wax per strip? How many coats of wax per Scrub? RESPONSE: The coats of wax per scrub are based on conditions and is determined by the Janitorial Services contractor. QUESTION #7: Who provides the chemicals for a strip & wax? RESPONSE: The contractor provides all required chemicals for strip & wax jobs. QUESTION #8: How many square feet of your floors is to be strip & wax in each building? RESPONSE: Refer to Attachment C, “Janitorial Service Locations Matrix” QUESTION #9: When we perform a strip & wax, would we be responsible for moving furniture? RESPONSE: The contract is responsible for moving furniture for strip and wax jobs. QUESTION #10: How many square feet is carpet? RESPONSE: Refer to Attachment C, “Janitorial Service Locations Matrix” QUESTION #11: What is the total square feet of your buildings? Each building? RESPONSE: Please refer to Attachment C, “Janitorial Service Locations Matrix,” and Attachment D, “Photographs of Floor Types in Service Areas.” QUESTION #12: Who supplies the cleaning supplies? RESPONSE: The contractor provides all cleaning supplies. 59 431717 QUESTION #13: Who supplies the paper & plastic,(toilet tissue, hand towels, hand soap) trash can liners? If contractor, what are the approx. previous or current cost? RESPONSE: The contractor provides all required supplies including but not limited to, the paper & plastic,(toilet tissue, hand towels, hand soap)trash can liners, etc. The cost of supplies and materials are included with the contractors monthly and annual fee for janitorial services. QUESTION #14: What hours are the current cleaning crew working? What days of week will we do service at each location? RESPONSE: Please refer to the Response to Question #5 and Attachment C, “Janitorial Service Locations Matrix for services hours and days of the week. QUESTION #15: What is your budget? RESPONSE: The annual budget for Janitorial Services is $130,000. QUESTION #16: Are there specific hours designated for cleaning? RESPONSE: Please refer to Attachment C, “Janitorial Service Locations Matrix, Pages 68 – 69 in the solicitation. QUESTION #17: Is there a Bond required? RESPONSE: No, a Bid or a Performance and Payment Bonds are NOT required. QUESTION #18: Will there be background requirements? If so, what is the level of background check required? RESPONSE: Please refer to the solicitation, “ATTACHMENT E - BACKGROUND SCREENING CHAPTER 435, FLORIDA STATUTES 435.04.” QUESTION #19: Are there any billable optional services. What were the annual billings for the optional services? RESPONSE: There may be requests for services that exceed the Scope of Services schedule such as additional carpet cleaning, floor striping and waxing, etc., that are billed individually and over and above the annual contract fee. QUESTION #20: Do we need to clean 2nd story or above exterior windows. 60 432718 RESPONSE: Yes, once per year at the Community Center. City Hall/Police 2nd floor, windows are cleaned on the inside only. QUESTION #21: Anticipated start date of service? RESPONSE: The estimated start date for service is March 15 to April. QUESTION #22: Any problems with any facilities who do we contact for repairs? RESPONSE: The Project Manager for Janitorial Services is the Public Works Department Assistant Director who will be the main contact for the contractor. QUESTION #23: Can i get a price list for each facility now. RESPONSE: Please refer to the Response to Question #3. QUESTION #24: What is the company name that is doing the cleaning now. RESPONSE: Please refer to the Response to Question #2. QUESTION #25: Paper Supplies will be delivered to every facility by the city or supply will be order by the city or the Vendor has to place order. RESPONSE: Please refer to the Response to Question #13. QUESTION #26: On 2.8. – Proposal Guaranty/ proposal Bond – each proposal must be accompanied by a proposal bond or cashier’s check in the amount of 5% of the proposal, in form provided (form 10). On bottom states that if the requirement for a proposal guaranty/ proposal bond is waived, the city will select box (the box is selected with an x) - question is I just want to make sure this is accurate no proposal guaranty/ proposal bond is required? RESPONSE: Please refer to the Response to Question #17. QUESTION #27: What is the value of the current contract for these services? RESPONSE: Please refer to the Response to Question #3. QUESTION #28: Are the custodians working on this contract members of a union? If so, which union? 61 433719 RESPONSE: To the City’s knowledge, the current custodians working on this contract are not members of an organized union. QUESTION #28: What is the contract start date for this project? RESPONSE: Please refer to the Response to Question #20. QUESTION #29: Are the service hours the window in which services are performed, or the required hours for service? For example, the Community Center service hours are Monday to Friday 6am to 12pm. Is the contractor required to provide 6 hours of service, or simply perform the required services between 6am and 12pm? RESPONSE: The contractor is expected to perform the services identified in the Scope of Services during the hours listed in Attachment C. QUESTION #30: In the RFP, page 16 item 2.8 indicates a proposal bond is required, however page 25 states a bid bond is not required for this project. Please clarify the bonds required for this project. RESPONSE: Please refer to the Response to Question #17. QUESTION #31: Is the contractor responsible for providing consumable supplies (paper, trash can liners, hand soap, etc.)? RESPONSE: Please refer to the Response to Question #13. QUESTION #32: We are inquiring on RFP-(RFP) No. FN2024-17-0-2024/SK, it is not clear if the square footage of the restrooms is included in the Square feet you provided on the RFP. RESPONSE: Yes, the restrooms are included in the square footage listed in Attachment C. For example, the Community Center restrooms are included in the square footage—2 restrooms downstairs (men and women) and 2 upstairs (men and women with showers). Attachment C also includes restroom square footage for the other facilities, that have restrooms, listed in Attachment C. QUESTION #33: Please clarify the meaning of “service hours” under section 3.2 Site Specifications and Location (p20). Does the use of the term mean the hours the buildings are operational/open to the public or does service hours designate the time identified for contractual cleaning of the building/facility? RESPONSE: Please refer to the Response to Question #29. QUESTION #34: Provide a count of bleachers in the gymnasium. 62 434720 RESPONSE: Individual bleacher counts are not available. The bleachers are connected and are located on each side of the court and fold out. The bleachers, there are 7 rows on each side of the gym . Total rows = 14 Each row sits roughly about 24 individuals, however that number can vary depending on the size of the person. Rough estimate = bleachers sit around 336 individuals. QUESTION #35 Confirm that cleaning of parking lots and exterior grounds are EXCLUDED from this RFP. RESPONSE: Yes, cleaning of parking lots and exterior grounds are EXCLUDED from the Scope of Services. QUESTION #36 Provide an estimated occupancy count or occupancy percentage for each building in the RFP. RESPONSE: The City does not have an occupancy count or occupancy percentage available. QUESTION #37: To ensure maximization of resources, can the Police building, Sylva Martin and Public Works buildings be proposed for evening cleaning? RESPONSE: Please refer to Attachment C, “Janitorial Service Locations Matrix, Pages 68 – 69 in the solicitation and the services hours for each location. QUESTION #38: Under section G Bi-annual Service (p23) confirm that the City is requesting the interior and exterior cleaning of ALL windows of the 6 buildings RESPONSE: Please refer to the Response to Question #2. IT SHALL BE THE SOLE RESPONSIBILITY OF THE BIDDER TO SECURE ADDENDUMS THAT MAY BE ISSUED FOR A SPECIFIC SOLICITATION 63 435721 64 436722 South’Miami THE CITY OF PITASANT LIVING October 1,2024 Email:mg@cleanspaceonline.com Matt Giunco,CEO Clean Space,Inc. 3764 NW 124th Avenue Coral Springs,Florida 33065 Re:Notice of Intent to Terminate Agreement and Amendment to Term and Rates Effective 10/01/2024 -Service Agreement for Janitorial Services dated October 1,2024 between City of South Miami and Clean Space, Inc.(“Contractor”)(the “Agreement”). Dear Mr.Giunco: In accordance with the Agreement,the City of South Miami (“City”)intends to terminate the Agreement early effective on or before March 31,2025,or within the next six months,and hereby agrees to amend the term of the Agreement to provide for a month-to-month term for a period of six months commencing October 1,2024 (the “Month-to-Month Term”).The City agrees to provide Contactor with 30-days advance written notice prior to the final termination date. The City hereby agrees to amend the Contract Price or monthly rate during the Month-to- Month Term,or until sooner terminated by the City,from $4,341.00 to $6,800.00 per month, effective October 1,2024.The Contractor shall continue to provide the Services on the same terms and conditions as required in the Agreement,with the exception of the monthly rate as amended herein. Per your letter attached,the Contractor has agreed to early termination of the Agreement, the Month-to-Month Term and the amended monthly rate.Please confirm acceptance and agreement to the terms of the letter and amendment to the Agreement by signing and acknowledging below. Should you have any questions regarding this matter,please feel free to contact me. Sincerely, cc:City Attorney Agreed to and Accepted By: Clean Space,Inc. Name &Title:^/7^0^,C&j Date:/g ///-2-^ Genaro “Chip”Iglesias,City Manager 65 437723 CLEAN SPACE INC. 3764 NW 124TH AVE CORAL SPRINGS FL,33065 CONTACT: 800.499.0116 CLEANSPACEONLINE.COM CleanSpace Commercial Cleaning Re:Upgrading monthly janitorial contract on a month-to-month basis To Whom It May Concern, Please accept this letter as confirmation of our intention to increase our monthly rates from the current amount of $4,341.00 per month to the new amount of $6,800.00 per month,effective October 1st. We understand that the City of South Miami will open bids again for this contract.We agree to maintain the current contract structure on a month-to-month basis for a maximum period of six months,from October 1st,2024,to March 31st,2025. Please do not hesitate to contact me if you require any further information or insights regarding Stephanie's qualifications and achievements.I can be reached at 954-880-5188 or mg@cleanspaceonline.com. Matt Giunco CEO Clean Space,Inc. CLIENTPOINT DOWNLOAD RECEIPT ------------------------------------------------------------------- DOWNLOADED: 01-22-2025 CLIENTPOINT ID: 1120040 438724